DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hry and helt

DIOPT Version :10

Sequence 1:NP_523977.2 Gene:hry / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_996948.1 Gene:helt / 404275 ZFINID:ZDB-GENE-040824-6 Length:270 Species:Danio rerio


Alignment Length:211 Identity:63/211 - (29%)
Similarity:90/211 - (42%) Gaps:62/211 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KETPLKSDRRSNKPIMEKRRRARINNCLNEL-KTLILDATKKDPARHSKLEKADILEKTVKHLQE 87
            |:||:     |:| ::|||||.|||.||||| ||:.:...|::   ..|||||:|||.||::|: 
Zfish    58 KKTPV-----SHK-VIEKRRRDRINRCLNELGKTVPMALAKQN---SGKLEKAEILEMTVQYLR- 112

  Fly    88 LQRQQAAMQQAADPK----------IVNKFKAGFADCV-NEVSRFPGIEPAQRR-----RLLQHL 136
                  |:..|..|:          ..|.|..|:.:|: |.|.....:|..:.:     |:|..|
Zfish   113 ------ALHSADFPRGREKGELLTEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFL 171

  Fly   137 SN------------CINGVKTELHQQQRQQQQQSIHAQMLPSPPSSPEQDSQQG-------AAAP 182
            .:            .|:...|:|..|...|.         |||..|..|.|..|       ..:|
Zfish   172 QSKVVTEPVFGSLGTISPDPTDLLCQLEYQS---------PSPTESVFQQSPPGHFSWHSSTRSP 227

  Fly   183 YL-FGIQQTASGYFLP 197
            .| :......|||..|
Zfish   228 TLAYPAMSQHSGYLSP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hryNP_523977.2 bHLH-O_hairy_like 30..88 CDD:381483 29/58 (50%)
ORANGE 106..141 CDD:128787 9/52 (17%)
heltNP_996948.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
bHLH-O_HELT 63..118 CDD:381414 30/65 (46%)
Hairy_orange 135..173 CDD:462193 9/37 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.