DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and her12

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_991182.1 Gene:her12 / 402914 ZFINID:ZDB-GENE-040824-5 Length:155 Species:Danio rerio


Alignment Length:118 Identity:44/118 - (37%)
Similarity:62/118 - (52%) Gaps:15/118 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KSDRRSNKPIMEKRRRARINNCLNELKTLI-LDATKKDPARHSKLEKADILEKTVKHLQELQRQQ 92
            |...:..|||:||.||.|||.|:::||:|: .:....||:  :|||||||||.||..|::..:||
Zfish    19 KEKIKLRKPIVEKMRRDRINTCIDQLKSLLEKEFHSHDPS--TKLEKADILEMTVSFLKQQIKQQ 81

  Fly    93 AAMQQAADPKIVNKFKAGFADCVNEVSRFPGIEPAQRRRLLQHLSNCINGVKT 145
            ..:.|       ..|..|::.|..|...|..:.  .....||||.   :|.||
Zfish    82 QQIPQ-------RDFNEGYSHCWRESVHFLSLH--SNAGELQHLH---SGPKT 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 29/59 (49%)
ORANGE 106..141 CDD:128787 9/34 (26%)
her12NP_991182.1 HLH 19..74 CDD:238036 28/56 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.