DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and hes6

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_919381.2 Gene:hes6 / 373116 ZFINID:ZDB-GENE-030828-5 Length:226 Species:Danio rerio


Alignment Length:316 Identity:73/316 - (23%)
Similarity:114/316 - (36%) Gaps:117/316 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAM 95
            ||::.||::||:||||||..|.||:.|:     .||....|:|.|::||.|||.::.:.:.:|..
Zfish    19 DRKTRKPLVEKKRRARINESLQELRLLL-----ADPDAQVKMENAEVLEMTVKRVESILQNKAKE 78

  Fly    96 QQAADPKIVNKFKAGFADCVNEVSRF----PGIEPAQRRRLLQHLSNCINGVKTELHQQQRQQQQ 156
            ..:.:.:...:|.||:..|::||..|    |||:......||.||..|:     .|:.::|   .
Zfish    79 ADSVNREANERFAAGYIQCMHEVHTFVSSCPGIDATIAADLLNHLLECM-----PLNDEER---F 135

  Fly   157 QSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKLPNGSIALVLPQSLP 221
            |.|.:.::        .||......|                |.....|..|.|:          
Zfish   136 QDILSDLI--------SDSNNSGTWP----------------GEAAYATLSPGGT---------- 166

  Fly   222 QQQQQQLLQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQRTASTGSASSHSSAGYESAPGSSSS 286
                                                          |.::..|:....||.::||
Zfish   167 ----------------------------------------------SVANGGSSALSPAPSTTSS 185

  Fly   287 ---CSYAPPSPANSSYEPMDIKPSVIQRVPMEQQPL--SLVIKKQIKEEEQPWRPW 337
               |         |..:..|.:.|.|.....:|.|:  :|...|.|      ||||
Zfish   186 DDIC---------SDLDDTDTEHSRISVDAGDQAPVVPTLYTNKSI------WRPW 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 26/56 (46%)
ORANGE 106..141 CDD:128787 15/38 (39%)
hes6NP_919381.2 HLH 18..75 CDD:238036 26/60 (43%)
Hairy_orange 90..128 CDD:284859 15/42 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.