DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and Hey

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster


Alignment Length:385 Identity:104/385 - (27%)
Similarity:152/385 - (39%) Gaps:118/385 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VVPAQLKETPLKSDRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTV 82
            :.|::.....|.| |:..:.::||:||.|||:.|.|||.|:..|.:|..:  :|||||:||:.||
  Fly    88 ISPSEPGSCQLMS-RKKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQGS--AKLEKAEILQLTV 149

  Fly    83 KHLQELQR----------QQAAMQQAADPKIVNKFKAGFADCVNEVSRF------PGIEPAQRRR 131
            :||:.||.          |:.||    |..|:     ||.:|..||:|:      ..|:...|.|
  Fly   150 EHLKSLQSKTLDSLSYDPQRVAM----DYHII-----GFRECAAEVARYLVTIEGMDIQDPLRLR 205

  Fly   132 LLQHLSNCINGVKTELHQQQRQQQQQSIHAQMLPSP----PSSPEQDSQQG--AAAPYLFGIQQT 190
            |:.||...:              ||:.:.|:...||    |::|.....|.  |||||.......
  Fly   206 LMSHLQYFV--------------QQRELSAKSCASPGGWSPAAPSSSGYQPNCAAAPYQSYAAPA 256

  Fly   191 ASGYFLPN---------------GMQVIPTKLPNGSIALVLP------------QSLPQQQQQQL 228
            ..|.::.:               |.:...::....::...||            |...||||||.
  Fly   257 NPGAYVSSYPTLSASPSQQAQQLGGRTSVSRTSGSAVTESLPSHDLHSDSSSQQQQQQQQQQQQQ 321

  Fly   229 LQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQRTASTGSASSHSSAGYE--------------- 278
            .||||||.|             |||....:.||.|........||:...|               
  Fly   322 QQHQQQQHQ-------------QQQQRTQTTPQPTQQQHYTHDHSAVHSEQQVPTYIELTNSNRP 373

  Fly   279 SAPGSSS-SCSYAPPSPANSSYEPMDIKPSVIQRVPMEQQPLSLVIKKQIKEEEQPWRPW 337
            :|.||.| |.|.||..|              :..:|.:....|.|::.......:|:|||
  Fly   374 AAIGSDSLSYSAAPQYP--------------VSGLPGQDYNNSSVLQYATPNGAKPYRPW 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 27/58 (47%)
ORANGE 106..141 CDD:128787 12/40 (30%)
HeyNP_523657.1 HLH 100..156 CDD:238036 27/58 (47%)
ORANGE 172..218 CDD:128787 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.