DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and heyl

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_859425.1 Gene:heyl / 335134 ZFINID:ZDB-GENE-030131-7074 Length:310 Species:Danio rerio


Alignment Length:279 Identity:86/279 - (30%)
Similarity:122/279 - (43%) Gaps:52/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQ 96
            |:..:.|:|||||.|||:.|:||:.|:..|.:|..:  ||||||:||:.||.||:.|........
Zfish    44 RKKRRGIIEKRRRDRINHSLSELRRLVPSAFEKQGS--SKLEKAEILQMTVDHLKLLHAMGGKGY 106

  Fly    97 QAADPKIVNKFKAGFADCVNEVSRF----PGIEPAQ--RRRLLQHLSNCINGVKTELHQQQRQQQ 155
            ..|....|:....||.:||.||.|:    .|:|.:.  ..||:.|||:|.:.:...|        
Zfish   107 FDARALAVDYRTLGFRECVGEVVRYLSSLEGVESSDPIGARLVSHLSHCASELDPLL-------- 163

  Fly   156 QQSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKLPNGSIALVLPQSL 220
             ||..|  ||.||.......|..||:|      ..:|..|.||..:.:   .|:|: |.:|....
Zfish   164 -QSPAA--LPFPPWPWASFPQLQAASP------PASSTPFPPNARRDL---TPHGT-ATILGYPS 215

  Fly   221 PQQQQQQLLQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQRTASTG---SASSHSSAGYESAPG 282
            |                 |:...:.:.......|.|.|:.|..:..|   ....||..| .:.|.
Zfish   216 P-----------------ALRMGSLSTQGTILNPALTSVRQLPSVPGHLHRLQQHSPEG-RTVPS 262

  Fly   283 SSSSCSYAPPSPANSSYEP 301
            ||||.|.:  ||...|:.|
Zfish   263 SSSSSSNS--SPPQISFRP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 28/55 (51%)
ORANGE 106..141 CDD:128787 15/40 (38%)
heylNP_859425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
HLH 44..101 CDD:238036 29/58 (50%)
ORANGE 115..159 CDD:128787 15/43 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..208 9/35 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..310 13/35 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.