DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and bhlhe40

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_997844.2 Gene:bhlhe40 / 324413 ZFINID:ZDB-GENE-030131-3133 Length:403 Species:Danio rerio


Alignment Length:351 Identity:79/351 - (22%)
Similarity:141/351 - (40%) Gaps:95/351 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQEL-----QRQQAAM-- 95
            ::||:||.|||.|:.:||.|:.:..|.....|  ||||.:||.|:||::.|     |:||..:  
Zfish    56 LIEKKRRDRINECIAQLKDLLPEHLKLTTLGH--LEKAVVLELTLKHVKALNNLLEQQQQKIISL 118

  Fly    96 -------QQAADPKIVNK--FKAGFADCVNEVSRFPGIEPAQR----RRLLQHLSNCINGVKTEL 147
                   :|...|...::  |::||..|..||.:|...:...|    ..:::||           
Zfish   119 QNGLQIGEQGNGPSENSEEMFRSGFHLCAKEVLQFLANQETMRDLTTAHIIEHL----------- 172

  Fly   148 HQQQRQQQQQSIHAQMLPSPPS----SPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKLP 208
                     |.:.::::.||||    .|...:|:....|  .|:|..|:.....|.:.||....|
Zfish   173 ---------QKVASELIQSPPSPRLDEPASKAQESREKP--SGLQPKAAEGHAKNCVPVIQRTYP 226

  Fly   209 NGSIALVLPQSLP------------QQQQQQLLQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQ 261
            :.|     .||..            :::.|:..:.....::......:::....|.:|     |.
Zfish   227 HSS-----EQSGSDTDTDSGYGGEYEKRDQKAQRPDCYVKESGALKYSSSIKEEQDEP-----PS 281

  Fly   262 RTASTGSASSHSSAGYESAPGSSSSCSYAPPSP-----------ANSSYEPMDIKPSVIQRVPM- 314
            :...:.|:...|.:|::...|.|...|::||.|           |.::|.||..|......:|: 
Zfish   282 KRPRSDSSEDESLSGHDVVGGHSPYVSFSPPQPLCMPFYLFPPGAAAAYLPMLEKCWYPGAMPVL 346

  Fly   315 -------------EQQPLSLVIKKQI 327
                         |:.|.|:|:..::
Zfish   347 YPGLGSSPASLSPEKLPSSMVMSSRV 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 22/49 (45%)
ORANGE 106..141 CDD:128787 10/40 (25%)
bhlhe40NP_997844.2 HLH 51..109 CDD:238036 23/54 (43%)
Hairy_orange 139..177 CDD:284859 11/57 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.