DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and Hes6

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001013197.1 Gene:Hes6 / 316626 RGDID:1312047 Length:234 Species:Rattus norvegicus


Alignment Length:321 Identity:76/321 - (23%)
Similarity:109/321 - (33%) Gaps:139/321 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQQ 97
            ::.||::||:||||||..|.||: |:|..|:.    .:|||.|::||.||:.:|...|.:|..::
  Rat    37 QARKPLVEKKRRARINESLQELR-LLLAGTEV----QAKLENAEVLELTVRRVQGALRGRARERE 96

  Fly    98 AADPKIVNKFKAGFADCVNEVSRFPGIEPAQRRRLLQHLSNCINGVKTELHQQQRQQQQQSIHAQ 162
            ....:...:|.||:..|::||..|              :|.|                 |:|.| 
  Rat    97 QLQAEASERFAAGYIQCMHEVHTF--------------VSTC-----------------QAIDA- 129

  Fly   163 MLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKLPNGSIALVLPQSLPQQQQQQ 227
                                       |.|.                                 :
  Rat   130 ---------------------------TVSA---------------------------------E 134

  Fly   228 LLQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQRTAST-GSASSHSSAGYESAPGSSSSCSY-- 289
            ||.|                       :|.|||.|..|: ......|.||   .||.|...|:  
  Rat   135 LLNH-----------------------LLESMPLREGSSFRDLLGDSLAG---LPGGSGRSSWPP 173

  Fly   290 --APPSPANSSYEPMD--------IKPSVIQRVPMEQQ---PLSLVIKKQIKEEEQPWRPW 337
              :|.||.:|...|.|        |..:.:.|||.|..   |.||.|....:..:..||||
  Rat   174 GGSPESPLSSPPGPGDDLCSDLEEIPEAELNRVPAEGPDLVPTSLGILTTARRAQSVWRPW 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 25/54 (46%)
ORANGE 106..141 CDD:128787 9/34 (26%)
Hes6NP_001013197.1 HLH 37..85 CDD:238036 24/52 (46%)
Hairy_orange 106..144 CDD:284859 19/152 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.