DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and Heyl

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001101447.1 Gene:Heyl / 313575 RGDID:1305022 Length:326 Species:Rattus norvegicus


Alignment Length:326 Identity:92/326 - (28%)
Similarity:134/326 - (41%) Gaps:92/326 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TAVVPAQLKETPLKSDRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEK 80
            |...|:|::.      |:..:.|:|||||.|||:.|:||:.|:..|.:|..:  ||||||::|:.
  Rat    34 TTPSPSQMQA------RKKRRGIIEKRRRDRINSSLSELRRLVPTAFEKQGS--SKLEKAEVLQM 90

  Fly    81 TVKHLQELQRQQAAMQQAADPKIVNKFKAGFADCVNEVSRFPGI--------EPAQRRRLLQHLS 137
            ||.||:.|.....|....|....|:....||.:|:.||.|:.|:        :|. |.|||.||:
  Rat    91 TVDHLKMLHASGGAGFFDARALAVDFRSIGFRECLTEVVRYLGVLEGPSSHADPV-RIRLLSHLN 154

  Fly   138 NCINGVKTELHQQQRQQQQQSIHAQMLPSPPSSPEQDSQQGAAA----PYLF-----GIQQTAS- 192
                                |..|:|.|||.::       ||.|    |:.|     |:...:| 
  Rat   155 --------------------SYAAEMEPSPTTT-------GALAFPVWPWSFLHSCPGLPSLSSQ 192

  Fly   193 --------GYFLPNGMQVIPTKLPNGSIALV----LPQSLPQQQQQQL---------LQHQQQQQ 236
                    |..|||   |.....|..::...    :|.::|..|:..|         ..|..::.
  Rat   193 LAILGRVPGPVLPN---VSSPPYPISALRSAPVHRVPGTIPPAQRNLLPSRGVTSSQRAHPPERP 254

  Fly   237 QLAVAAAAAAAAAAQQQPML-VSMPQRTASTGSASSHSSAGYESAPGSSSSCSYAPPSPANSSYE 300
            ......|....||....|:| .|.|   |:.|:..|.     :||.||.||     |||...:..
  Rat   255 AAPPPTALGVRAARSIVPILPCSSP---AAPGAGKSD-----DSASGSISS-----PSPLGPTGR 306

  Fly   301 P 301
            |
  Rat   307 P 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 27/58 (47%)
ORANGE 106..141 CDD:128787 14/42 (33%)
HeylNP_001101447.1 bHLH-O_HEYL 36..109 CDD:381453 31/80 (39%)
ORANGE 115..162 CDD:128787 17/67 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334631
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.