DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and her3

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_571155.1 Gene:her3 / 30289 ZFINID:ZDB-GENE-980526-204 Length:229 Species:Danio rerio


Alignment Length:306 Identity:82/306 - (26%)
Similarity:121/306 - (39%) Gaps:93/306 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQ 96
            ::.:||:|||:||||||.|||:||:| |::...:..|..|||||||||.|||||:.||..:..:.
Zfish    17 KKVSKPLMEKKRRARINKCLNQLKSL-LESACSNNIRKRKLEKADILELTVKHLRHLQNTKRGLS 80

  Fly    97 QAADPKIVNKFKAGFADCVNEVSRFPGIEPAQRRRLLQHLSNCINGVKTELHQQQRQQQQQSIHA 161
            :|.|..   ::.||:..|:|.||.:.......|......|:|..:|:.   |.:           
Zfish    81 KACDSA---EYHAGYRSCLNTVSHYLRASDTDRDSRSIMLTNLTSGLN---HNR----------- 128

  Fly   162 QMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKLPNGSIALVLPQSLPQQQQQ 226
              :|. .|:.|.|       |.|.        :.||:              .|..|..:|.:...
Zfish   129 --VPD-FSTVESD-------PALI--------FTLPS--------------TLRRPHKVPIRTDV 161

  Fly   227 QLLQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQRTASTGSASSHSSAGYESAPGSSSSCSYAP 291
            .....||               .|:::..|  ||:||....|......|...|.....:..::  
Zfish   162 SYSSFQQ---------------TAERKVCL--MPKRTEIGDSDRMSLDAALRSQESKKAETTH-- 207

  Fly   292 PSPANSSYEPMDIKPSVIQRVPMEQQPLSLVIKKQIKEEEQPWRPW 337
                   :.|.|:|  ||:          ..|.||     ..||||
Zfish   208 -------FRPKDLK--VIE----------CCIFKQ-----NYWRPW 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 33/55 (60%)
ORANGE 106..141 CDD:128787 9/34 (26%)
her3NP_571155.1 HLH 17..77 CDD:238036 35/60 (58%)
ORANGE 88..129 CDD:128787 11/56 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.