DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and her6

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_571154.2 Gene:her6 / 30288 ZFINID:ZDB-GENE-980526-144 Length:270 Species:Danio rerio


Alignment Length:353 Identity:105/353 - (29%)
Similarity:145/353 - (41%) Gaps:129/353 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AVVPAQLKETPLK-----SDRRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKAD 76
            |..||.:..||.|     ..|:|:|||||||||||||..|.:||||||||.|||.:|||||||||
Zfish    15 AATPASMNTTPDKPKTASEHRKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKAD 79

  Fly    77 ILEKTVKHLQELQRQQAAMQQAADPKIVNKFKAGFADCVNEVSRF----PGIEPAQRRRLLQHLS 137
            |||.|||||:.:||.|.......||.::.|::|||::|:|||:||    .|:....|.|||.||:
Zfish    80 ILEMTVKHLRNMQRAQMTAALNTDPTVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLA 144

  Fly   138 NCINGVKTELHQQQRQQQQQSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQV 202
            :|:..:....:..|.|          :|:.|..|.                       ....|..
Zfish   145 SCMTQINAMNYPTQHQ----------IPAGPPHPS-----------------------FSQPMVQ 176

  Fly   203 IPTKLPNGSIALVLPQSLPQQQQQQLLQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQRTASTG 267
            ||                                            :|.||..:|.:......:|
Zfish   177 IP--------------------------------------------SATQQANVVPLSGVPCKSG 197

  Fly   268 SASSHSS------AGYESAPGSSS-------SCSYAPPSP-----ANSSYEPMDI-----KPSVI 309
            |:|:.:|      .|::..|.:..       :.::||..|     ||:|..|:.:     .||| 
Zfish   198 SSSNLTSDATKVYGGFQLVPATDGQFAFLIPNAAFAPNGPVIPVYANNSNTPVPVAVSPGAPSV- 261

  Fly   310 QRVPMEQQPLSLVIKKQIKEEEQPWRPW 337
                               ..:..||||
Zfish   262 -------------------TSDSVWRPW 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 45/63 (71%)
ORANGE 106..141 CDD:128787 18/38 (47%)
her6NP_571154.2 HLH 32..95 CDD:238036 46/62 (74%)
Hairy_orange 110..148 CDD:284859 17/37 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7581
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427802at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105205
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3450
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.