DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and HEY1

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001035798.1 Gene:HEY1 / 23462 HGNCID:4880 Length:308 Species:Homo sapiens


Alignment Length:370 Identity:84/370 - (22%)
Similarity:130/370 - (35%) Gaps:140/370 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NMTNVLGTAVVPAQLKETPLKSD----RRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARH 69
            |:::.||:.        :|..|.    |:..:.|:|||||.||||.|:||:.|:..|.:|.....
Human    31 NLSSALGSM--------SPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQVMEQ 87

  Fly    70 --SKLEKADILEKTVKHLQELQRQQAAMQQAADPKIVNKFKAGFADCVNEVSRF----PGIEPAQ 128
              :|||||:||:.||.||:.|..........|....::....||.:|:.||:|:    .|::.:.
Human    88 GSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASD 152

  Fly   129 --RRRLLQHLSNCINGVKTELHQQQRQ-------------------QQQQSIHAQMLP------- 165
              |.||:.||:|         :..||:                   ......|..:||       
Human   153 PLRVRLVSHLNN---------YASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNA 208

  Fly   166 ---SPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGMQVIPTKLPNGSIALVLPQSLPQQQQQQ 227
               :.|:.|....:.|:|.|       .|.....|          |:||:..|||          
Human   209 GTTASPTEPHHQGRLGSAHP-------EAPALRAP----------PSGSLGPVLP---------- 246

  Fly   228 LLQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQRTASTGSASSHSSAGYESAPGSSSSCSYAPP 292
                             ...:|::..|.|:|              |.|...:.|.|..|.....|
Human   247 -----------------VVTSASKLSPPLLS--------------SVASLSAFPFSFGSFHLLSP 280

  Fly   293 SPANSSYEPMDIKPSVIQRVPMEQQPLSLVIKKQIKEEEQPWRPW 337
            :.         :.||    .|.:...|.           :|:|||
Human   281 NA---------LSPS----APTQAANLG-----------KPYRPW 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 29/64 (45%)
ORANGE 106..141 CDD:128787 13/40 (33%)
HEY1NP_001035798.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 6/28 (21%)
bHLH_SF 41..126 CDD:381792 32/84 (38%)
ORANGE 124..170 CDD:128787 14/54 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..238 9/54 (17%)
YRPW motif 298..301 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.