DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and Hey2

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_569101.1 Gene:Hey2 / 155430 RGDID:621405 Length:339 Species:Rattus norvegicus


Alignment Length:323 Identity:84/323 - (26%)
Similarity:134/323 - (41%) Gaps:56/323 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQ 96
            |:..:.|:|||||.||||.|:||:.|:..|.:|..:  :|||||:||:.||.||:.||.......
  Rat    49 RKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGS--AKLEKAEILQMTVDHLKMLQATGGKGY 111

  Fly    97 QAADPKIVNKFKAGFADCVNEVSRF----PGIEPAQ--RRRLLQHLSNCINGVKTELHQQQRQQQ 155
            ..|.....:....||.:|:.||:|:    .|::|:.  |.||:.|||.|.:       |::....
  Rat   112 FDAHALATDFMSIGFRECLTEVARYLSSVEGLDPSDPLRVRLVSHLSTCAS-------QREAAVM 169

  Fly   156 QQSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGM---QVIPTKLPNGSIALVLP 217
            ..|:.....|..|       ...|||     .....:....|||:   :..|.:|...|      
  Rat   170 TSSMSHHHHPLHP-------HHWAAA-----FHHLPTSLLQPNGLHTSESTPCRLSTSS------ 216

  Fly   218 QSLPQQQQQQLLQHQQQQQQLAVAAAAAAAAAAQQQPMLVSMPQRTASTGSASSHSSAGYESAPG 282
             .:|......||.........|:...:....|....|:..|:     .:.||:.|::|...:|..
  Rat   217 -EVPPAHGSALLTATFAHADSALRMPSTGTVAPCVPPLSTSL-----LSLSATVHAAAAAATAAA 275

  Fly   283 SSSSCSYA---PPSPANSSYEPMDIKPSVIQRVPMEQQPLSLVIKKQIKE-----EEQPWRPW 337
            .|...|:|   |..|:|::      ..:.:........|||:......::     ..:|:|||
  Rat   276 HSFPLSFAGAFPMLPSNAA------AAAAVAAATAISPPLSVSAASSPQQTSSGTNSKPYRPW 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 28/55 (51%)
ORANGE 106..141 CDD:128787 15/40 (38%)
Hey2NP_569101.1 HLH 49..105 CDD:238036 29/57 (51%)
ORANGE 120..165 CDD:128787 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.