DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment h and hes2

DIOPT Version :9

Sequence 1:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_002933889.1 Gene:hes2 / 100038090 XenbaseID:XB-GENE-486138 Length:191 Species:Xenopus tropicalis


Alignment Length:161 Identity:64/161 - (39%)
Similarity:83/161 - (51%) Gaps:32/161 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RRSNKPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQ 96
            |::.||:||||||||||..||:||||||....||.:|:||||||||||.||:.|:::....|  |
 Frog    29 RKTLKPLMEKRRRARINESLNQLKTLILPLIGKDNSRYSKLEKADILEMTVRFLRDIPPVPA--Q 91

  Fly    97 QAADPKIVNKFKAGFADCVNEVSRFPG----IEPAQRRRLLQHL--------SNCINGVKTE--- 146
            ..||     ::|.|:..||..:|....    :......|||.||        |:|.:..|:.   
 Frog    92 NPAD-----RYKEGYRACVERLSAILNKSHVLTGEASNRLLNHLQRSPELCCSDCHHPPKSHSPR 151

  Fly   147 --LHQQQRQQQ-------QQSIHAQMLPSPP 168
              ||...|..|       |.|.| :..|.||
 Frog   152 IVLHVSPRTSQLESPLLNQPSSH-RPAPCPP 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hNP_001014577.1 HLH 29..88 CDD:238036 37/55 (67%)
ORANGE 106..141 CDD:128787 12/46 (26%)
hes2XP_002933889.1 bHLH-O_HES2 25..89 CDD:381469 37/59 (63%)
Hairy_orange 97..133 CDD:369405 10/35 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1427802at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.