DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex7 and APAF1

DIOPT Version :9

Sequence 1:NP_001137914.1 Gene:Pex7 / 38994 FlyBaseID:FBgn0035922 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_863651.1 Gene:APAF1 / 317 HGNCID:576 Length:1248 Species:Homo sapiens


Alignment Length:369 Identity:84/369 - (22%)
Similarity:142/369 - (38%) Gaps:97/369 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HGYSLRFSPFEANYLLLA-----TSQLYGLA--------GGGSLFL--LEQNSNTNSS------- 54
            :|:.|...|| .|.:.|.     ||::|..|        ..|.|:|  :.:.:.||.|       
Human   551 NGHLLGRQPF-PNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWINKKNITNLSRLVVRPH 614

  Fly    55 ---------STDGQSLG--------ELCRLEWSDGLF-------DVAWCPYAAD--IAATASGDG 93
                     |.|||.:.        ::.:.|..:.|.       :|..|.::.|  ..||.|.|.
Human   615 TDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEVLCCAFSTDDRFIATCSVDK 679

  Fly    94 SLQIWCGLDGESASNQLTPKQPLICLQEHKNEVYSLDWGEKWNYHTLLSGSWDCTLKLWDCNRQN 158
            .::||..:.||....          ..||..:|....:....::..|.:||.||.|||||.|::.
Human   680 KVKIWNSMTGELVHT----------YDEHSEQVNCCHFTNSSHHLLLATGSSDCFLKLWDLNQKE 734

  Fly   159 SITTFVGHNDLIYGAKFSPLIANLFASVSTDGHLNLWNSLDFAGKPLMSIE---------AHASE 214
            ...|..||.:.:...:||| ...|.||.|.||.|.||::.....:..::::         ....|
Human   735 CRNTMFGHTNSVNHCRFSP-DDKLLASCSADGTLKLWDATSANERKSINVKQFFLNLEDPQEDME 798

  Fly   215 AL--CCDWSHFDRNVLVTGGSDGLIRGWDLRKMRTHVFELYS----GEF------AVRRLACSPH 267
            .:  ||.||.....::|..            |.:..:|::::    ||.      .::....||.
Human   799 VIVKCCSWSADGARIMVAA------------KNKIFLFDIHTSGLLGEIHTGHHSTIQYCDFSPQ 851

  Fly   268 S-AAVLASANYDFTTRIWNLERGESAQEVNARHTEFVCGLDWNP 310
            : .||:|.:.|  ...:||.:......:... |..:|.|:.::|
Human   852 NHLAVVALSQY--CVELWNTDSRSKVADCRG-HLSWVHGVMFSP 892

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex7NP_001137914.1 WD40 53..328 CDD:295369 69/313 (22%)
WD40 repeat 74..121 CDD:293791 11/55 (20%)
WD40 <85..>328 CDD:225201 59/248 (24%)
WD40 repeat 126..164 CDD:293791 13/37 (35%)
WD40 repeat 171..209 CDD:293791 12/37 (32%)
WD40 repeat 215..251 CDD:293791 6/37 (16%)
WD40 repeat 259..296 CDD:293791 8/37 (22%)
WD40 repeat 303..328 CDD:293791 3/8 (38%)
APAF1NP_863651.1 CARD_APAF1 7..92 CDD:260034
NB-ARC 129..374 CDD:395745
APAF1_C 453..587 CDD:407760 10/36 (28%)
WD40 607..910 CDD:238121 69/312 (22%)
WD 1-1 613..652 6/38 (16%)
WD40 repeat 623..655 CDD:293791 6/31 (19%)
WD 1-2 655..694 11/38 (29%)
WD40 repeat 660..697 CDD:293791 11/46 (24%)
WD 1-3 697..738 14/40 (35%)
WD40 repeat 703..741 CDD:293791 12/37 (32%)
WD 1-4 741..780 14/39 (36%)
WD40 repeat 746..791 CDD:293791 12/45 (27%)
WD 1-5 796..836 10/51 (20%)
WD40 repeat 802..870 CDD:293791 17/81 (21%)
WD 1-6 838..877 8/40 (20%)
WD 1-7 880..910 4/14 (29%)
WD40 repeat 885..939 CDD:293791 3/8 (38%)
Interpropeller linker. /evidence=ECO:0000250 910..921
WD 2-1 922..958
WD 2-2 959..998
WD40 961..1234 CDD:238121
WD40 repeat 964..990 CDD:293791
WD 2-3 1001..1040
WD40 repeat 1006..1030 CDD:293791
WD 2-4 1042..1080
WD40 repeat 1047..1082 CDD:293791
WD 2-5 1083..1122
WD40 repeat 1089..1124 CDD:293791
WD 2-6 1125..1164
WD40 repeat 1130..1172 CDD:293791
WD 2-7 1175..1212
WD40 repeat 1180..1213 CDD:293791
WD 2-8 1213..1248
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.