DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex7 and Pex7

DIOPT Version :9

Sequence 1:NP_001137914.1 Gene:Pex7 / 38994 FlyBaseID:FBgn0035922 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001029319.1 Gene:Pex7 / 308718 RGDID:1308483 Length:318 Species:Rattus norvegicus


Alignment Length:324 Identity:137/324 - (42%)
Similarity:185/324 - (57%) Gaps:20/324 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RHGYSLRFSPFEANYLLLATSQLYGLAGGGSLFLLEQNSNTNSSSTDGQSLGELCRLEWSDGLFD 75
            ||||::.|||:....|..|.:|.||:||.|:|.:|:||.:         .|......:|:|||||
  Rat    12 RHGYAVEFSPYLPGRLACAAAQHYGIAGCGTLLVLDQNES---------GLQIFRSFDWNDGLFD 67

  Fly    76 VAWCPYAADIAATASGDGSLQIWCGLDGESASNQLTPKQPLICLQEHKNEVYSLDWGEKWNYHTL 140
            |.|......:..|.|||||||:|   |...|:.      ||...:||..||||:||.:..:...:
  Rat    68 VTWSENNEHVLVTCSGDGSLQLW---DTAKATG------PLQVYKEHTQEVYSVDWSQTRDEQLV 123

  Fly   141 LSGSWDCTLKLWDCNRQNSITTFVGHNDLIYGAKFSPLIANLFASVSTDGHLNLWNSLDFAGKPL 205
            :|||||.|:|:||....||:.||.||..:||...:||.|...|||.|.|..|.:|: :...|..:
  Rat   124 VSGSWDQTVKVWDPTVGNSLCTFRGHESVIYSTIWSPHIPGCFASASGDQTLRIWD-VKTTGVRI 187

  Fly   206 MSIEAHASEALCCDWSHFDRNVLVTGGSDGLIRGWDLRKMRTHVFELYSGEFAVRRLACSPHSAA 270
            : |.||.:|.|.|||..::.|:||||..|..:||||||.:|..||||....:|:||:..||..|:
  Rat   188 V-IPAHQAEILSCDWCKYNENLLVTGAVDCSLRGWDLRNVRQPVFELLGHTYAIRRVKFSPFHAS 251

  Fly   271 VLASANYDFTTRIWNLERGESAQEVNARHTEFVCGLDWNPHRTHQLADCGWDSLANVYTPQCLS 334
            ||||.:||||.|.||..:.:...|....||||.||||.:.....::|||.||....:|.|.||:
  Rat   252 VLASCSYDFTVRFWNFSKPDPLLETVEHHTEFTCGLDLSLQSPTEVADCSWDETVKIYNPVCLA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex7NP_001137914.1 WD40 53..328 CDD:295369 114/274 (42%)
WD40 repeat 74..121 CDD:293791 17/46 (37%)
WD40 <85..>328 CDD:225201 105/242 (43%)
WD40 repeat 126..164 CDD:293791 17/37 (46%)
WD40 repeat 171..209 CDD:293791 12/37 (32%)
WD40 repeat 215..251 CDD:293791 18/35 (51%)
WD40 repeat 259..296 CDD:293791 17/36 (47%)
WD40 repeat 303..328 CDD:293791 9/24 (38%)
Pex7NP_001029319.1 WD40 repeat 15..60 CDD:293791 16/44 (36%)
WD40 <41..311 CDD:225201 114/269 (42%)
WD40 63..310 CDD:238121 108/246 (44%)
WD40 repeat 65..104 CDD:293791 17/38 (45%)
WD40 repeat 110..148 CDD:293791 14/37 (38%)
WD40 repeat 153..190 CDD:293791 17/36 (47%)
WD40 repeat 197..234 CDD:293791 14/36 (39%)
WD40 repeat 240..278 CDD:293791 20/37 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335293
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0277
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H242
Inparanoid 1 1.050 260 1.000 Inparanoid score I3027
OMA 1 1.010 - - QHG53887
OrthoDB 1 1.010 - - D350307at33208
OrthoFinder 1 1.000 - - FOG0006273
OrthoInspector 1 1.000 - - oto96649
orthoMCL 1 0.900 - - OOG6_102912
Panther 1 1.100 - - LDO PTHR46027
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5222
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.