DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arr2 and sagb

DIOPT Version :9

Sequence 1:NP_523976.1 Gene:Arr2 / 38993 FlyBaseID:FBgn0000121 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001028921.1 Gene:sagb / 619268 ZFINID:ZDB-GENE-050913-98 Length:176 Species:Danio rerio


Alignment Length:150 Identity:68/150 - (45%)
Similarity:104/150 - (69%) Gaps:2/150 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFKKATPNGKVTFYLGRRDFIDHIDYCDPVDGVIVVEPDYLKNRKVFGQLATTYRYGREEDEVMG 71
            ::||.:.:..|..|:|:|||:||.|:.||||||::::|:.:|::|||..|:.|:|||||:.:|||
Zfish     7 IYKKISRDKSVGVYMGKRDFVDHCDFVDPVDGVVLIDPEQVKDKKVFVMLSCTFRYGREDMDVMG 71

  Fly    72 VKFSKELILCREQIVPMTNPNMEM--TPMQEKLVRKLGSNAYPFTFHFPPNSPSSVTLQQEGDDN 134
            :.|.:::.||..|:.|........  |.:|||::||||.||:||.|.||.|.|.|||||...:|.
Zfish    72 MAFRRDIFLCMRQVYPPLQDKERSIHTKVQEKILRKLGGNAHPFFFEFPDNLPCSVTLQPAPNDV 136

  Fly   135 GKPLGVEYTIRAFVGDSEDD 154
            ||...||:.::||..:::||
Zfish   137 GKQCAVEFEVKAFCAENQDD 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arr2NP_523976.1 Arrestin_N 17..172 CDD:278754 65/139 (47%)
Arrestin_C 192..350 CDD:214976
sagbNP_001028921.1 Arrestin_N 17..150 CDD:304627 63/132 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D783081at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.