DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arr2 and arrb1

DIOPT Version :9

Sequence 1:NP_523976.1 Gene:Arr2 / 38993 FlyBaseID:FBgn0000121 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001153294.1 Gene:arrb1 / 553266 ZFINID:ZDB-GENE-060824-1 Length:418 Species:Danio rerio


Alignment Length:404 Identity:173/404 - (42%)
Similarity:258/404 - (63%) Gaps:29/404 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVFKKATPNGKVTFYLGRRDFIDHIDYCDPVDGVIVVEPDYLKNRKVFGQLATTYRYGREEDEVM 70
            :|||||:||||:|.|||:|||:||:|..:|||||::::|:|||.||||..|...:|||||:.:|:
Zfish     7 RVFKKASPNGKLTVYLGKRDFVDHVDLVEPVDGVVLIDPEYLKERKVFVTLTCAFRYGREDLDVL 71

  Fly    71 GVKFSKELILCREQ-IVPMTNPNMEMTPMQEKLVRKLGSNAYPFTFHFPPNSPSSVTLQQEGDDN 134
            |:.|.|:|.:...| ..|:......:|.:||:|::|||.:||||||..|||.|.|||||...:|.
Zfish    72 GLTFRKDLFVANIQAFPPVPEEKKSLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDT 136

  Fly   135 GKPLGVEYTIRAFVGDSEDDRQHKRSMVSLVIKKLQYAPLNRGQRLPSSLVSKGFTFSNGKISLE 199
            ||..||::.::||..::.:::.|||:.|.|||:|:||||...|.: |.:..::.|..|:..:.||
Zfish   137 GKACGVDFEVKAFCAENVEEKIHKRNSVRLVIRKVQYAPEKPGPQ-PMAETTRQFLMSDKPLHLE 200

  Fly   200 VTLDREIYYHGEKTAATVQVSNNSKKSVKSIKCFIVQHTEITMVN-AQFSKHVAQLETKEGCPIT 263
            .:||:|||||||..:..|.|:||:.|:||.||..:.|:.:|.:.| ||:...||..|:.:  .:.
Zfish   201 ASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAIEESDD--IVA 263

  Fly   264 PGANLTKTFYLIPLAANNKDRHGIALDGHLKDEDVNLASSTMVQEGKSTGDACGIVISYSVRIKL 328
            |.|...|.:.|.|..|||:::.|:||||.||.||.||||||:::|| :..:..||::||.|::||
Zfish   264 PSATFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREG-ANKEILGIIVSYKVKVKL 327

  Fly   329 ---NCGTLGGEMQTDV----PFKLLQPAPGTIEKK------RSNAMKKMKSIEQHRNVKGYYQDD 380
               ..|.||....:||    ||.|:.|.|  :|:.      .::|......||        :..:
Zfish   328 VVSRGGLLGDLASSDVAVELPFTLMHPKP--LEESIYRDAPENDAPIDTNLIE--------FDTN 382

  Fly   381 DDNIVFEDFAKMRM 394
            ||:|:|||||:.|:
Zfish   383 DDDIIFEDFARQRL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arr2NP_523976.1 Arrestin_N 17..172 CDD:278754 74/155 (48%)
Arrestin_C 192..350 CDD:214976 70/165 (42%)
arrb1NP_001153294.1 Arrestin_N 18..174 CDD:278754 74/155 (48%)
Arrestin_C 193..356 CDD:214976 70/165 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.