DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arr2 and arr3a

DIOPT Version :9

Sequence 1:NP_523976.1 Gene:Arr2 / 38993 FlyBaseID:FBgn0000121 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001002405.1 Gene:arr3a / 436678 ZFINID:ZDB-GENE-040718-102 Length:357 Species:Danio rerio


Alignment Length:356 Identity:137/356 - (38%)
Similarity:218/356 - (61%) Gaps:15/356 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVFKKATPNGKVTFYLGRRDFIDHIDYCDPVDGVIVVEPDYLKNRKVFGQLATTYRYGREEDEVM 70
            ||:||.:.||::|.|||:||::||:|..|.|:|.:.::|..|.::||:.|||..:|||||:.:|:
Zfish     4 KVYKKTSGNGQLTLYLGKRDYVDHVDVVDAVEGAVKIDPADLGDKKVWVQLACAFRYGREDLDVI 68

  Fly    71 GVKFSKELILCREQIVPMTNPNMEMTPMQEKLVRKLGSNAYPFTFHFPPNSPSSVTLQQEGDDNG 135
            |:.|.|::.:...|:.|.......:|.|...|::|.|...:||||:.|.|.|.|||||...||.|
Zfish    69 GLSFRKDIWIQHIQLYPEAGHKPTLTEMHNTLLKKAGEQGHPFTFNIPTNLPCSVTLQPGPDDKG 133

  Fly   136 KPLGVEYTIRAFVGDSEDD---RQHKRSMVSLVIKKLQYAPLNRGQRLPSSLVSKGFTFSNGKIS 197
            |..||::.::|:|..|.||   :..|:....|||:|:|:||.|.|....:.| .|.|..|:..:.
Zfish   134 KACGVDFEVKAYVAKSADDPDEKVDKKDTCRLVIRKIQFAPDNTGSGQKAEL-CKSFMMSDKPVL 197

  Fly   198 LEVTLDREIYYHGEKTAATVQVSNNSKKSVKSIKCFIVQHTEITMVNA-QFSKHVAQLETKEGCP 261
            ||.:|::||||||:.....:::.|.:.|.||.|:..:.|.|::.:.:| :::|:|  |..:.|..
Zfish   198 LEASLEKEIYYHGDPIPVNIKIKNETNKVVKRIRVTVDQTTDVVLYSADKYTKNV--LTEEFGET 260

  Fly   262 ITPGANLTKTFYLIPLAANNKDRHGIALDGHLKDEDVNLASSTMVQEGKSTGDACGIVISYSVRI 326
            :...::..|:..:.||.||||::.|:||||.|||||.||||:|:::.|... :..||::||.:::
Zfish   261 VEANSSFEKSLDITPLLANNKEKRGLALDGRLKDEDTNLASTTIIRTGMDK-EMLGILVSYKIKV 324

  Fly   327 KL---NCGTLGGEMQTDV----PFKLLQPAP 350
            .|   ..|.|||...:||    |..|:.|.|
Zfish   325 NLMVSGGGLLGGLTASDVTVELPLTLMHPKP 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arr2NP_523976.1 Arrestin_N 17..172 CDD:278754 64/157 (41%)
Arrestin_C 192..350 CDD:214976 59/165 (36%)
arr3aNP_001002405.1 Arrestin_N 36..173 CDD:304627 53/136 (39%)
Arrestin_C 192..355 CDD:214976 59/165 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.