DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arr2 and ARR3

DIOPT Version :9

Sequence 1:NP_523976.1 Gene:Arr2 / 38993 FlyBaseID:FBgn0000121 Length:401 Species:Drosophila melanogaster
Sequence 2:XP_016885007.1 Gene:ARR3 / 407 HGNCID:710 Length:403 Species:Homo sapiens


Alignment Length:398 Identity:142/398 - (35%)
Similarity:233/398 - (58%) Gaps:39/398 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVFKKATPNGKVTFYLGRRDFIDHIDYCDPV---------------DGVIVVEPDYLKNRKVFGQ 55
            |||||.:.|||::.|||:|||:||:|..:|:               |||::|:|:|||.||:|..
Human     3 KVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIGEFFLTKVLSVLLSTDGVVLVDPEYLKCRKLFVM 67

  Fly    56 LATTYRYGREEDEVMGVKFSKELILCREQIVP--MTNPNMEMTPMQEKLVRKLGSNAYPFTFHFP 118
            |...:||||::.||:|:.|.|:|.:...|:||  .::|...:|.:||:|:.|||.||||||....
Human    68 LTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMV 132

  Fly   119 PNSPSSVTLQQEGDDNGKPLGVEYTIRAFVGDSEDDRQHKRSMVSLVIKKLQYAPLNRGQRLPSS 183
            .|.|.|||||...:|.|||.|:::.:::|..::.::...||..|.||::|:|:||...|.. ||:
Human   133 TNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPG-PSA 196

  Fly   184 LVSKGFTFSNGKISLEVTLDREIYYHGEKTAATVQVSNNSKKSVKSIKCFIVQHTEITMVNA-QF 247
            ...:.|..|...:.|:..:|||::||||..:..|.::|.:.|.:|.||..:.|.|::.:.:. ::
Human   197 QTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKY 261

  Fly   248 SKHVAQLETKEGCPITPGANLTKTFYLIPLAANNKDRHGIALDGHLKDEDVNLASSTMVQEGKST 312
            :|.|...|..|  .:...::.:::|.:.|:.|.:..:.|:||||.||.||.||||||:::.|...
Human   262 TKTVFIQEFTE--TVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASSTIIRPGMDK 324

  Fly   313 GDACGIVISYSVRIKL--NCGTLGGEMQ-----TDVPFKLLQPAPG---------TIEK-KRSNA 360
             :..||::||.||:.|  :||.:.|::.     .::|..|:.|.|.         .||: .|...
Human   325 -ELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSHEAASSEDIVIEEFTRKGE 388

  Fly   361 MKKMKSIE 368
            .:..|::|
Human   389 EESQKAVE 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arr2NP_523976.1 Arrestin_N 17..172 CDD:278754 69/171 (40%)
Arrestin_C 192..350 CDD:214976 53/165 (32%)
ARR3XP_016885007.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.