DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arr2 and CG32683

DIOPT Version :9

Sequence 1:NP_523976.1 Gene:Arr2 / 38993 FlyBaseID:FBgn0000121 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001285084.1 Gene:CG32683 / 31970 FlyBaseID:FBgn0052683 Length:804 Species:Drosophila melanogaster


Alignment Length:563 Identity:127/563 - (22%)
Similarity:207/563 - (36%) Gaps:206/563 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVFKKATPNGKVTFYLGRRDFIDHIDYCDPVDGVIVVEPDYLKNRKVFGQLATTYRYGREEDEVM 70
            :|:||.:||..:|.||..|:.....:....:.|::.|:|..::..:|:.||..|:|||||::|||
  Fly   103 RVYKKTSPNCVLTLYLPTREITLTGNNPSVLRGIVYVDPKAIQGYRVYAQLTLTFRYGREDEEVM 167

  Fly    71 GVKFSKELILCREQIVP-MTNPNME-MTPMQEKLVRKLGSNAYPFTFHFPPNSPSSVTLQQEGDD 133
            |::|..|.|:...||.| :..|..| ::|:||.|:::||..|:|||......:|.||.|......
  Fly   168 GLRFCNEAIMSLHQIWPRLEEPTPESLSPLQEALMKRLGDGAHPFTLSLSSYAPPSVQLVPAKRY 232

  Fly   134 NGKPLGVEYTIRAFVGDSEDDRQHKRSMVSLVIKKL-------------QYAPL----------- 174
            .|.|:|..|.:|.|:.|..|::.|:|:.|.:.::.:             |||..           
  Fly   233 YGAPIGTSYDVRCFIADKTDEKFHRRASVKMGVRVIYRTDVFHQHLAPEQYAAFAGRQNIAQSPP 297

  Fly   175 --------------------NRGQRLPSS------------------LVSKGFTFS--------- 192
                                .:.|..|||                  |..|.|.||         
  Fly   298 ASATPPSCGEGGEQHTTHTQQQSQSQPSSGSKHKSKSERGDSFPKLRLSPKSFRFSGRFGRSKSE 362

  Fly   193 ----------------------------------------------------------NGKISLE 199
                                                                      :|::.|.
  Fly   363 IEKCPNDPFHSYSKSFQEHCDSMLPPHTGAGVTGGIGGVSVGPCGGPQGSVDKPFLLHDGRVGLR 427

  Fly   200 VTLDREIYYHGEKTAATVQVSNNSKKSVKSIKCFIVQHTEITMV-NAQFSKHVAQLETKEGCPIT 263
            .:||:..|.|||....||.:.|:|:|:|:.::...:||.::.|. |.:|...||..:.     :|
  Fly   428 ASLDKGWYTHGEDVQVTVNIRNDSRKTVRKVRVCAIQHVDVCMFNNGKFKNVVADSDN-----VT 487

  Fly   264 P--------GANLTKTFYLIPLAANNKDRHGIALDGHL----KDEDVN--LASST------MVQE 308
            |        ||:|..|..|.|.....|  :.|||:..|    :.|::.  :|:|.      ::|.
  Fly   488 PPVDRTVAAGASLNTTVTLRPQRGPTK--NWIALEDTLQRSTEPEEITGAIAASAIRSPHFVMQN 550

  Fly   309 GKSTGDACG------------------------------------------IVISYSVRIKLNCG 331
            .:..| .||                                          |.:||.|::||...
  Fly   551 AQLLG-GCGHPLGSPALVTPHPHLWQPGSQGQGQPGNPNSGGGNEERNVFAIYVSYYVKVKLTLS 614

  Fly   332 TLGGEMQTDVPFKLLQ----PAPGTIEKKRSNAMKKMKSIEQH 370
            .:|||:...:||.|:.    ..||...........:|:.:..|
  Fly   615 GMGGELSLKLPFVLVHVDETQRPGFASATLGELRMEMERLALH 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arr2NP_523976.1 Arrestin_N 17..172 CDD:278754 54/169 (32%)
Arrestin_C 192..350 CDD:214976 54/291 (19%)
CG32683NP_001285084.1 Arrestin_N 135..268 CDD:304627 49/132 (37%)
Arrestin_C 421..632 CDD:214976 53/218 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470070
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.802101 Normalized mean entropy S2648
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D34511at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.