DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arr2 and Sag

DIOPT Version :9

Sequence 1:NP_523976.1 Gene:Arr2 / 38993 FlyBaseID:FBgn0000121 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_033144.1 Gene:Sag / 20215 MGIID:98227 Length:403 Species:Mus musculus


Alignment Length:399 Identity:159/399 - (39%)
Similarity:242/399 - (60%) Gaps:34/399 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFKKATPNGKVTFYLGRRDFIDHIDYCDPVDGVIVVEPDYLKNRKVFGQLATTYRYGREEDEVMG 71
            :|||.:.:..||.|||:||::||:...:|||||::|:|:.:|.:||:..|...:|||:|:.:|||
Mouse    13 IFKKVSRDKSVTIYLGKRDYVDHVSQVEPVDGVVLVDPELVKGKKVYVTLTCAFRYGQEDIDVMG 77

  Fly    72 VKFSKELILCREQIVPMTNPNMEMTPMQEKLVRKLGSNAYPFTFHFPPNSPSSVTLQQEGDDNGK 136
            :.|.::|...|.|:.|.......:|.:||.|::|||.|.|||...||...|.||.||....|.||
Mouse    78 LTFRRDLYFSRVQVYPPVGAMSVLTQLQESLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDVGK 142

  Fly   137 PLGVEYTIRAF---VGDSEDDRQHKRSMVSLVIKKLQYAPLNRGQRLPSSLVSKGFTFSNGKISL 198
            ..||::.::||   :.|.|:|:..|:|.|.|:|:|:|:||...|.: ||:..|..|..|:..::|
Mouse   143 SCGVDFEVKAFASDITDPEEDKIPKKSSVRLLIRKVQHAPPEMGPQ-PSAEASWQFFMSDKPLNL 206

  Fly   199 EVTLDREIYYHGEKTAATVQVSNNSKKSVKSIKCFIVQHTEITMVNAQ-FSKHVAQLETKEGCPI 262
            .|:|.:|||:|||....||.|:||:.|.||.||..:.|...:.:.::. :.|.||..||:|  .:
Mouse   207 SVSLSKEIYFHGEPIPVTVTVTNNTDKVVKKIKVSVEQIANVVLYSSDYYVKPVASEETQE--KV 269

  Fly   263 TPGANLTKTFYLIPLAANNKDRHGIALDGHLKDEDVNLASSTMVQEGKSTGDACGIVISYSVRIK 327
            .|.:.||||..|:||.|||::|.||||||.:|.||.||||||:::||... ...||::||.:::|
Mouse   270 QPNSTLTKTLVLVPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDR-TVMGILVSYHIKVK 333

  Fly   328 LN-CGTLG----GEMQTDVPFKLLQPAPGTIEKKRSNAMKKMKSIEQHRNVKGYYQDDDDNIVFE 387
            |. .|.||    .|:.|:|||:|:.|.|....|         :|::            |:|:|||
Mouse   334 LTVSGFLGELTSSEVATEVPFRLMHPQPEDPAK---------ESVQ------------DENLVFE 377

  Fly   388 DFAKMRMNN 396
            :||:..:.:
Mouse   378 EFARQNLKD 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arr2NP_523976.1 Arrestin_N 17..172 CDD:278754 67/157 (43%)
Arrestin_C 192..350 CDD:214976 72/163 (44%)
SagNP_033144.1 Interaction with RHO. /evidence=ECO:0000269|PubMed:28753425 11..19 3/5 (60%)
Arrestin_N 23..181 CDD:334019 67/157 (43%)
Arrestin_C 200..361 CDD:214976 72/163 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..403 0/6 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.