DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arr2 and Arr3

DIOPT Version :9

Sequence 1:NP_523976.1 Gene:Arr2 / 38993 FlyBaseID:FBgn0000121 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001177922.1 Gene:Arr3 / 171107 RGDID:621385 Length:381 Species:Rattus norvegicus


Alignment Length:400 Identity:142/400 - (35%)
Similarity:239/400 - (59%) Gaps:36/400 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFKKATPNGKVTFYLGRRDFIDHIDYCDPVDGVIVVEPDYLKNRKVFGQLATTYRYGREEDEVMG 71
            ||||.:.|||.:.|||:|||:|.:|..:|:||||:|:|:|||.||:|.:|...:||||::.:|:|
  Rat     4 VFKKTSSNGKFSIYLGKRDFVDDVDTVEPIDGVILVDPEYLKGRKMFVRLTCAFRYGRDDLDVIG 68

  Fly    72 VKFSKELILCREQIVPMTNPNME--MTPMQEKLVRKLGSNAYPFTFHFPPNSPSSVTLQQEGDDN 134
            :.|.|:|.:..:|:.|....:::  :|.:||:|:.|||.||||||.....|.|.|||||...:|:
  Rat    69 LTFRKDLYVQTKQVAPAEPTSIQGPLTALQERLLHKLGVNAYPFTLQMVANLPCSVTLQPGPEDS 133

  Fly   135 GKPLGVEYTIRAFVGDSEDDRQHKRSMVSLVIKKLQYAPLNRGQRLPSSLVSKGFTFSNGKISLE 199
            |||.||::.:::|..::.:::..|...|.||::|:|::.|..|.. |.:...:.|..|:..:.|:
  Rat   134 GKPCGVDFEVKSFCAENLEEKISKSDSVQLVVRKVQFSALEPGPG-PWAQTIRSFFLSSQPLQLQ 197

  Fly   200 VTLDREIYYHGEKTAATVQVSNNSKKSVKSIKCFIVQHTEITMVNA-QFSKHVAQLETKEGCPIT 263
            ..:|||::||||..:..|.::|.:.|.::.||..::|.|::.:.:. :::|.|...|..|  .:.
  Rat   198 AWMDREVHYHGEAISVHVSINNYTNKVIRRIKIAVIQITDVVLYSLDKYTKTVFIREFTE--TVA 260

  Fly   264 PGANLTKTFYLIPLAANNKDRHGIALDGHLKDEDVNLASSTMVQEGKSTGDACGIVISYSVRIKL 328
            ..::.::||.:.||.|.|:.:.|:||||.||.||.||||||:::.|.:. :..||::||.|::.|
  Rat   261 ANSSFSQTFAVTPLLAANRQKQGLALDGKLKHEDTNLASSTILRPGMNK-ELLGILVSYKVKVNL 324

  Fly   329 NC---GTLGGEMQTDV----PFKLLQPAPGTIEKKRSNAMKKMKSIEQHRNVKGYYQDDDDNIVF 386
            ..   |.|||...:||    |..|:.|.|...|:..:.:                    .::||.
  Rat   325 MVSYGGILGGLPASDVGVELPLILIHPKPPHGERAVATS--------------------SEDIVV 369

  Fly   387 EDFAKMRMNN 396
            |:|  |:.|:
  Rat   370 EEF--MQQNS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arr2NP_523976.1 Arrestin_N 17..172 CDD:278754 66/156 (42%)
Arrestin_C 192..350 CDD:214976 57/165 (35%)
Arr3NP_001177922.1 Arrestin_N 14..171 CDD:278754 66/156 (42%)
Arrestin_C 190..353 CDD:214976 57/165 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.