DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66D and Cpr92F

DIOPT Version :10

Sequence 1:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster


Alignment Length:115 Identity:35/115 - (30%)
Similarity:50/115 - (43%) Gaps:22/115 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LSLQQQNEEEEYDDQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYTA 204
            :|.|.|:    .|..:.:|.:|:  .|.....::.|.  .||:. .||||.||..|.:::|.|||
  Fly    23 VSTQYQH----LDPHSHTYSYGY--ADPNSQKHETRS--HDGTT-HGSYSYVDGHGHVQSVSYTA 78

  Fly   205 DPKEGFKAEVIREPTDIVVKIPTPP----PPTQLLRAGGHKAQQEYSSGP 250
            ||..||.|        :...:|..|    .|. ...|..|.|...|:.||
  Fly    79 DPHHGFNA--------VGTNLPQAPQVHAAPV-YAAAHAHGAYAPYAHGP 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:459790 19/51 (37%)
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:459790 19/51 (37%)

Return to query results.
Submit another query.