DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66D and Ccp84Aa

DIOPT Version :10

Sequence 1:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:157 Identity:49/157 - (31%)
Similarity:71/157 - (45%) Gaps:42/157 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 AQQQQGYVAPSVRDYQQYQPQQAAYRPPAQAAPQPPRRIQQSSYQAPSTSILGKGQHKLSLQQQN 146
            |..|..:.||:|..| .:.|...|.:...:||                                 
  Fly    23 AAPQVYHAAPAVATY-AHAPVAVAQKVVVKAA--------------------------------- 53

  Fly   147 EEEEYDDQNSSYQFGFDVKDDEFT-NYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYTADPKEGF 210
              ||| |.:..|:|.:.| ||:.| :.:.:.|.|||.|::|.||::|:||:.|.|:|||||..||
  Fly    54 --EEY-DPHPQYRFSYGV-DDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGF 114

  Fly   211 KAEVIREPTDIVVKIPTPPPPTQLLRA 237
            .|.|.|||   :||.....|..:.:.|
  Fly   115 NAVVNREP---LVKAVAVAPVVKTVAA 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:459790 24/52 (46%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:459790 24/52 (46%)

Return to query results.
Submit another query.