DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66D and Cpr76Bd

DIOPT Version :9

Sequence 1:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster


Alignment Length:145 Identity:50/145 - (34%)
Similarity:73/145 - (50%) Gaps:18/145 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 GYVAPSVRDYQQYQPQQAAYRPPAQAAPQPPRRIQQSSY--QAPSTSILGKGQHKLSLQQQNEEE 149
            |.:.|....:.:|.|.     .||.::..|   :..::|  .||.|      ||.:......:..
  Fly  1097 GGIGPLGAGFYRYAPS-----VPALSSHAP---VAATAYLKSAPVT------QHAVLKVVPEKHL 1147

  Fly   150 EYDDQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYTADPKEGFKAEV 214
            |:.|.:..|.|.:.|.|....:.:::||.|||.|:||.||:|:.||.:|||||.||.:.||.|||
  Fly  1148 EHFDAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFHAEV 1212

  Fly   215 I--REPTDIVVKIPT 227
            |  |:...||.|..|
  Fly  1213 INSRDQGKIVAKRQT 1227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:278791 24/51 (47%)
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.