DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66D and Cpr72Ea

DIOPT Version :9

Sequence 1:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster


Alignment Length:124 Identity:30/124 - (24%)
Similarity:50/124 - (40%) Gaps:23/124 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 DQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYTADPKEGFKAEVIRE 217
            |:...|.:|:   .:..::.|..:.: || :.:|.||..|:.|.::||.|.||.| ||..     
  Fly    44 DELGQYSYGY---SEPLSSKQETRTL-DG-ITQGYYSYRDAAGKLQTVNYVADNK-GFHV----- 97

  Fly   218 PTDIVVKIPTPPPPTQLL----RAGGHKAQQ--EYSSGPSKQQYQH---QQQQQQPQYH 267
               ....:|....|.:.|    |:..|....  |:.:..|....||   ....:.|.:|
  Fly    98 ---AATNLPKAKVPQESLEFSPRSASHPVDHHVEHHAEVSHAVVQHPVGHHPIEVPHHH 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:278791 16/51 (31%)
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.