DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66D and Cpr62Bc

DIOPT Version :10

Sequence 1:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_647668.1 Gene:Cpr62Bc / 38241 FlyBaseID:FBgn0035281 Length:180 Species:Drosophila melanogaster


Alignment Length:92 Identity:34/92 - (36%)
Similarity:49/92 - (53%) Gaps:12/92 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 YQAPSTSILGKGQHKLSLQQQNEEEEYDDQNS--SYQFGFDVKDDEFTNYQNRKEIRDGSVIKGS 187
            |.|......|.|.|          :|..|.::  .|.:.:.|.|....:.:::.|:|||.|:|||
  Fly    29 YAAAPAIYAGHGHH----------DEGIDYHAYPKYHYNYGVADSHTGDVKSQHEVRDGDVVKGS 83

  Fly   188 YSVVDSDGFIRTVKYTADPKEGFKAEV 214
            ||:|:.||.:|||:||||...||.|.|
  Fly    84 YSLVEPDGSVRTVEYTADDHNGFNAVV 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:459790 23/51 (45%)
Cpr62BcNP_647668.1 Chitin_bind_4 54..106 CDD:459790 23/51 (45%)

Return to query results.
Submit another query.