DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66D and Cpr62Ba

DIOPT Version :10

Sequence 1:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_647666.2 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster


Alignment Length:65 Identity:20/65 - (30%)
Similarity:31/65 - (47%) Gaps:1/65 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 YDDQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKY-TADPKEGFKAEV 214
            :|::...|...:.:.|.....:...:|.|.|..:.||||.::..|.||:|.| ......||||.|
  Fly    38 HDEERLHYSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRSVHYEVRGANRGFKAVV 102

  Fly   215  214
              Fly   103  102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:459790 14/52 (27%)
Cpr62BaNP_647666.2 Chitin_bind_4 45..89 CDD:459790 13/43 (30%)

Return to query results.
Submit another query.