DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66D and Cpr49Ab

DIOPT Version :10

Sequence 1:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster


Alignment Length:136 Identity:35/136 - (25%)
Similarity:52/136 - (38%) Gaps:13/136 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 PPAQAAPQP------PRRIQQSSYQAPSTSILGKGQHKLSLQQQNEEEEYDDQNSSYQFGFDVKD 166
            |...|.|||      |..|...:...|.....|:|.:..::.:|.::.|.|..:..::....:..
  Fly   121 PRTSARPQPRPTTAAPPAIADPTANLPKGRGTGEGGNGWAIIRQEDDVEVDGYHYLWETENGILG 185

  Fly   167 DEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYTADPKEGFKAEVIREPTDIVVKIPTPPPP 231
            :|....:...| .:|...||.|.....||.:..|.|.|| ..||.......||     .|.|||.
  Fly   186 EESGRIEKLTE-EEGLRSKGFYEYTGPDGILYRVDYVAD-DNGFVPSAAHLPT-----APPPPPY 243

  Fly   232 TQLLRA 237
            .:.|.|
  Fly   244 VEKLLA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:459790 12/51 (24%)
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 12/55 (22%)

Return to query results.
Submit another query.