DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66D and Cpr35B

DIOPT Version :10

Sequence 1:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster


Alignment Length:150 Identity:41/150 - (27%)
Similarity:63/150 - (42%) Gaps:43/150 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 HKLSLQQQNEE-----------EEYDDQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVV 191
            |..|....:||           :::.|.::.|.|.:.|||.:..:.:::.|.|.|..:.|.|.::
  Fly    41 HLTSHDDHHEEHHGHHHDHHGHDDHHDSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELI 105

  Fly   192 DSDGFIRTVKYTADPKEGFKAEVIREPTDIVVKIPTPPPPTQLLR---------------AGGHK 241
            |:||..|||.||||..:||:|.|.||.                |.               .|||.
  Fly   106 DADGHKRTVHYTADKHKGFEAHVHREK----------------LHDHHQAEHHGHGHSGYEGGHV 154

  Fly   242 AQQEYSSGPSKQQYQHQQQQ 261
            ..:|:|| .|...|.|..::
  Fly   155 EFEEHSS-QSGHDYGHGHEE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:459790 20/51 (39%)
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:459790 20/51 (39%)

Return to query results.
Submit another query.