DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr66D and Crys

DIOPT Version :9

Sequence 1:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001285854.1 Gene:Crys / 34604 FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster


Alignment Length:209 Identity:52/209 - (24%)
Similarity:84/209 - (40%) Gaps:59/209 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 IQQSSYQAP-STSILGKGQHKLSLQQQ----------------------NEEEEYDDQNSSYQFG 161
            :..|:|..| ..:.|.|..:....|||                      |..|:||.: ..|.|.
  Fly    17 VANSAYLRPIDLNQLAKSSNLQQQQQQQLRGALNRDDNNDDDDATTLAPNSNEDYDTR-PQYSFA 80

  Fly   162 FDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYTADPKEGFKAEVIREPTD------ 220
            :||:|....:.:.::|.|||.::||.||:::.||..|.|:||||...||.|.|.::..|      
  Fly    81 YDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVSKQRLDEQQQQR 145

  Fly   221 ----------IVVKIPT---------------PPPPTQL-LRAGGHKAQQEYSSGPSKQ---QYQ 256
                      .:.::.|               ....:|| |.|...:..:..:...::|   |:|
  Fly   146 LSASTSSRFNSLEELQTRLTAQAIAEAQSLVEAQQASQLQLEAQNRRESENQARNQAQQLMEQFQ 210

  Fly   257 HQQQQQQPQYHQYQ 270
            .|.|||:.|..|.:
  Fly   211 QQVQQQEQQRLQQE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:278791 21/51 (41%)
CrysNP_001285854.1 Chitin_bind_4 77..129 CDD:278791 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.