DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and CYTIP

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_004279.3 Gene:CYTIP / 9595 HGNCID:9506 Length:359 Species:Homo sapiens


Alignment Length:252 Identity:53/252 - (21%)
Similarity:90/252 - (35%) Gaps:68/252 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTSRSSASASFSRPAFW-------------KVPGYELPTSYRPQPTPKPPLVPLPSPCRRRSSS 52
            :..:|||:.:.||    |             :..|:|: .|||||.         .:.|.....:
Human    59 LALTRSSSLSDFS----WSQRKLVTVEKQDNETFGFEI-QSYRPQN---------QNACSSEMFT 109

  Fly    53 GLKKRVHFADEQNVGVQVGSPAH-GELLRGDIISKIGEYDARDLSHADAQQLFRGAGN------- 109
            .:.|           :|..|||| ..|..||:::.|........::.....|.|.:||       
Human   110 LICK-----------IQEDSPAHCAGLQAGDVLANINGVSTEGFTYKQVVDLIRSSGNLLTIETL 163

  Fly   110 -----------EIRLVVHRDNK----IAYTQGATQEAG--PGSRSN-STLPPVTPDLMPHRGPSP 156
                       |.:|.|.:...    :.|.....||..  .|..:| .:|..:..|.:...||.|
Human   164 NGTMILKRTELEAKLQVLKQTLKQKWVEYRSLQLQEHRLLHGDAANCPSLENMDLDELSLFGPLP 228

  Fly   157 FLPGPSHFERALQLPVDTLPQTVFPQ--LNSSGGYEVPSTVFSPKPTRDHQQDVDEE 211
            . |||:..:|. :|..::..::....  ::|..||:...:..|.:.....|...|:|
Human   229 G-PGPALVDRN-RLSSESSCKSWLSSMTMDSEDGYQTCVSEDSSRGAFSRQTSTDDE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 15/65 (23%)
DUF4749 285..359 CDD:292558
CYTIPNP_004279.3 PDZ_signaling 76..161 CDD:238492 22/105 (21%)
Interaction with CYTH1 166..188 3/21 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.