DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and PDLIM1

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_066272.1 Gene:PDLIM1 / 9124 HGNCID:2067 Length:329 Species:Homo sapiens


Alignment Length:403 Identity:70/403 - (17%)
Similarity:120/403 - (29%) Gaps:176/403 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EQNVGVQVGSP----AHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAY 123
            ||.:.:...:|    |...|..||:|:.|...:..:::|.:||...:|..:.:.|.|.|..    
Human    25 EQPLAISRVTPGSKAALANLCIGDVITAIDGENTSNMTHLEAQNRIKGCTDNLTLTVARSE---- 85

  Fly   124 TQGATQEAGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGG 188
                                       |:                                    
Human    86 ---------------------------HK------------------------------------ 87

  Fly   189 YEVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRHYPNPAVRA 253
                  |:||..|.:.::           .||:..                   |...|...:  
Human    88 ------VWSPLVTEEGKR-----------HPYKMN-------------------LASEPQEVL-- 114

  Fly   254 HPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNI---EDTIRSTVPFAT 315
            |.|..::.|.|....:.        :.:.|.||...|:|:|.||||:.||   .:.:.|....:.
Human   115 HIGSAHNRSAMPFTASP--------ASSTTARVITNQYNNPAGLYSSENISNFNNALESKTAASG 171

  Fly   316 SESNRLKDSPL-HRPLPTKLNGYKKTVQYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKV 379
            .|:|   ..|| |...|:.|        ...:.||.|:.:||:   ....:...|..:..|..::
Human   172 VEAN---SRPLDHAQPPSSL--------VIDKESEVYKMLQEK---QELNEPPKQSTSFLVLQEI 222

  Fly   380 YQ------PNRLVPGKKPVSAPVSRPPYNVVNT-------------------------HDE---- 409
            .:      ||: ..|.:.|.|||::...::.|.                         |.|    
Human   223 LESEEKGDPNK-PSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVC 286

  Fly   410 -----NIRQSGSF 417
                 |::|.|.|
Human   287 TDCGTNLKQKGHF 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 12/50 (24%)
DUF4749 285..359 CDD:292558 24/77 (31%)
PDLIM1NP_066272.1 PDZ_signaling 10..82 CDD:238492 14/56 (25%)
DUF4749 138..230 CDD:318205 26/105 (25%)
LIM_CLP36 260..311 CDD:188832 6/40 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5310
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.180

Return to query results.
Submit another query.