DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and YHP1

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_010739.3 Gene:YHP1 / 852062 SGDID:S000002859 Length:353 Species:Saccharomyces cerevisiae


Alignment Length:364 Identity:75/364 - (20%)
Similarity:112/364 - (30%) Gaps:107/364 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFS---- 197
            |.:|:.|..|:::.....|||             .:.|||.|.||. :..|...:|....|    
Yeast     3 SRNTVLPSLPNIITGTSNSPF-------------QLHTLPNTNFPS-DDQGDIRLPPLAASAHIV 53

  Fly   198 -------------PKPTRDHQQDVDEEQAAIVNQPYRT--TPLVLPGAKVKKDAPTTESYLRHYP 247
                         .:|.|...|.||     .::|...|  |||..| .|:...:|.|        
Yeast    54 RPVVNIYKSPCDEERPKRKSPQAVD-----FLSQRVTTSMTPLSKP-KKLSSHSPFT-------- 104

  Fly   248 NPAVRA----HPGHDYHDSIMKQRV------ADTMLHKVVGSEADTGRVF--HKQFNSPIGLYSN 300
             |.||.    .|....| |..|..:      |..:|......|......|  |.|...|......
Yeast   105 -PTVRVCSKEQPPQSMH-SYKKVNILTPLSAAKAVLTPTTRKEKKRSFAFITHSQETFPKKEPKI 167

  Fly   301 NNIEDTIRSTVPFATSESNRLKDSPLHRPLPTK---------LNGYKKTVQYDPRNSETYRAIQE 356
            :|.....|.....::.|...|:.:....|.|.|         .|..:|:||...:|........:
Yeast   168 DNARLARRKRRRTSSYELGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKKHK 232

  Fly   357 EGG-------YSN-------YGQSSPQEVTIPVQTK-----------------VYQPNRLVPGKK 390
            ..|       :||       |..::.:..:.|..||                 :::.:.:.|.|.
Yeast   233 NSGNTSHCKVHSNDSMSMISYSDAALEITSTPTSTKEAITAELLKTSPANTSSIFEDHHITPCKP 297

  Fly   391 PVSAPVSRPPYNVVNT-----HDENIRQ-SGSFNRLMYS 423
            .......|....|..|     |.|.|:. .|..|||.::
Yeast   298 GGQLKFHRKSVLVKRTLSNTGHSEIIKSPKGKENRLKFN 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492
DUF4749 285..359 CDD:292558 16/84 (19%)
YHP1NP_010739.3 COG5576 123..278 CDD:227863 27/154 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.