DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Pard3b

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_006496361.1 Gene:Pard3b / 72823 MGIID:1919301 Length:1238 Species:Mus musculus


Alignment Length:375 Identity:78/375 - (20%)
Similarity:112/375 - (29%) Gaps:115/375 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GELLR-----GDIISKIGEYDARDLSHADAQQLFRGAGNEIRL-VVHRDNKIAYTQG----ATQE 130
            |.:||     .|.:.|..:..|:...|.:.::|.|......|: ..|::.:....:|    ||..
Mouse   908 GAMLRFGKKKDDKVGKAEQKGAQKSGHPEEEELERMKEERERIGAKHQELREKQARGLVDYATAV 972

  Fly   131 AGP------------GSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQL 183
            .||            .:|.|....|.. .....|.|||...||      |..|.|..|       
Mouse   973 TGPVHDMDDDEMDPNYARVNHFREPCA-SANVFRSPSPLRAGP------LAYPRDGRP------- 1023

  Fly   184 NSSGGYEVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRHYPN 248
                        .||    ||.:.:    .|.||:||....|...|..:.......:...:.|..
Mouse  1024 ------------LSP----DHLEGL----YAKVNKPYHPPALADSGRPMAGTTDRIQKLRKEYYQ 1068

  Fly   249 PAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFN--------------------- 292
              .|......|.|...:.|.:|..|..|.|...| |...:.:|.                     
Mouse  1069 --ARREGFLLYEDENTRARPSDHDLRWVSGKGPD-GSTHNLRFEGMERQYASLPRGGSADPVDYL 1130

  Fly   293 --SPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLH-------RPLPTKLNGYKKTVQYDPRNS 348
              ||.|.|::..:        |:...      ..|:|       ||...:....:....|.|.  
Mouse  1131 TASPRGRYNDREL--------PYYPG------PHPVHAPRGSYPRPPDLRATDLRYPQYYPPP-- 1179

  Fly   349 ETYRAIQEEGGY-SNYGQSSPQEVTIPVQTKVYQP-NRLVP-GKKPVSAP 395
               .|.|.:|.: .:...|.||...:|    |||. .|..| |..|...|
Mouse  1180 ---PAHQHKGPFRQDVPPSPPQHQRVP----VYQEMGRAGPRGSSPDQYP 1222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 10/44 (23%)
DUF4749 285..359 CDD:292558 14/103 (14%)
Pard3bXP_006496361.1 DUF3534 2..74 CDD:338230
PDZ_signaling 236..323 CDD:238492
PDZ 415..504 CDD:214570
PDZ_signaling 536..624 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.