DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Slc9a3r2

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_075542.2 Gene:Slc9a3r2 / 65962 MGIID:1890662 Length:337 Species:Mus musculus


Alignment Length:245 Identity:57/245 - (23%)
Similarity:82/245 - (33%) Gaps:70/245 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LPTSYRP-QPTPK------------------PPLVPLPSPCR-RRSSSGLKKRVHFADEQNVG-- 67
            ||.::.| :|.|.                  ||....|..|. ||...|....:| :|:...|  
Mouse   112 LPPAHNPWEPKPDWACSGSLGSDTGQKDVNGPPRELRPRLCHLRRGPQGYGFNLH-SDKSRPGQY 175

  Fly    68 ---VQVGSPA-HGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGAT 128
               |..|||| |..|...|.:.::...:...|.||:.....:...:|.||:|             
Mouse   176 IRSVDPGSPASHSGLRAQDRLIEVNGQNVEGLRHAEVVARIKAQEDEARLLV------------- 227

  Fly   129 QEAGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPV--DTLPQTVFPQLNSSGGYEV 191
                           |.|:...|......:|...|.|..|..||  .|.|    .|||  ||...
Mouse   228 ---------------VDPETDEHFKRLRVIPTEEHVEGPLPSPVTNGTSP----AQLN--GGSVC 271

  Fly   192 PSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVL--PGAKVKKDAPTT 239
            .|....|...:|     :|:.:.....|::.:.|.|  ..|:.|:.|..|
Mouse   272 SSRSDLPGSEKD-----NEDGSTWKRDPFQESGLHLSPTAAEAKEKARAT 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 14/47 (30%)
DUF4749 285..359 CDD:292558
Slc9a3r2NP_075542.2 PDZ_signaling 9..88 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..147 7/34 (21%)
PDZ 148..230 CDD:214570 24/110 (22%)
EBP50_C 232..337 CDD:286142 25/96 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..337 24/86 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.