DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Pdzk1

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_113900.1 Gene:Pdzk1 / 65144 RGDID:70924 Length:523 Species:Rattus norvegicus


Alignment Length:398 Identity:82/398 - (20%)
Similarity:139/398 - (34%) Gaps:114/398 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KKRVHFAD--EQNVGVQVGSPAHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIR-LVVH 116
            ||.|...|  .|.|.::.|      :|..|.:.::...:..:.||.:..:....:|:.|. |:|.
  Rat   155 KKGVFLTDITPQGVAMKAG------VLADDHLIEVNGENVENASHEEVVEKVTKSGSRIMFLLVD 213

  Fly   117 RDNKIAYTQGATQEAGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFP 181
            ::....:::..|    |..|..::|     .|:||:                       |:.|..
  Rat   214 KETARCHSEQKT----PFKRETASL-----KLLPHQ-----------------------PRVVVI 246

  Fly   182 QLNSSG-GYEVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRH 245
            :..|:| |:.:.:   .|           |::..|:..       :.||      :|...:.|::
  Rat   247 KKGSNGYGFYLRA---GP-----------EQKGQIIKD-------IEPG------SPAEAAGLKN 284

  Fly   246 YPNPAVRAHPGHDY----HDSI--MKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIE 304
              |..|.|..|...    |||:  |.:...|.....|:..|||  |::.....||: ||..:   
  Rat   285 --NDLVVAVNGESVEALDHDSVVEMIRNGGDQTTLLVLDKEAD--RIYSLARFSPL-LYCQS--- 341

  Fly   305 DTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTVQYDPRNSETYRAIQEEGGYS---NYGQS 366
                ..:|     :..:|::|.....|.:..|...|........:..|.|:|:..|.   |..:.
  Rat   342 ----QELP-----NGSVKEAPAPISAPLEAPGSATTEDVGDHKPKLCRLIKEDDSYGFHLNAIRG 397

  Fly   367 SPQEVTIPVQ-----TKVYQPNR----LVPGKKPVSAPVSRPPYNVVNTHDENIRQSGSFNRLMY 422
            .|......||     .|....|.    .|.|:.     |...||:.|   .|.|:.||....|: 
  Rat   398 QPGSFVKEVQQGGPADKAGLENEDIIIEVNGEN-----VQDEPYDRV---VERIKSSGEHVTLL- 453

  Fly   423 SVIGATEY 430
             |.|...|
  Rat   454 -VCGKVAY 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 8/47 (17%)
DUF4749 285..359 CDD:292558 14/73 (19%)
Pdzk1NP_113900.1 PDZ_signaling 7..87 CDD:238492
PDZ 132..212 CDD:214570 14/62 (23%)
PDZ_signaling 242..320 CDD:238492 20/106 (19%)
PDZ 375..455 CDD:214570 21/89 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 479..523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.