DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and PDLIM2

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_067643.3 Gene:PDLIM2 / 64236 HGNCID:13992 Length:602 Species:Homo sapiens


Alignment Length:492 Identity:98/492 - (19%)
Similarity:138/492 - (28%) Gaps:222/492 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SRPAFWKVPGYEL---PTSYR-------PQP--------TPKPPLVP-----LPSPCRR----RS 50
            :|||   :||..|   |.|.|       |.|        .|:..|.|     |..|.||    ||
Human   158 ARPA---LPGAGLLSAPLSARNPGLVRGPAPWSLASAGAPPRAALSPAGALLLQPPARRVLCPRS 219

  Fly    51 SSGLK------------KRVHFADEQN------VGVQVGSPA----------------------- 74
            ..|.:            :....|:..:      :.|.|..||                       
Human   220 EGGSRTGRAGPSGWAPPRGARSAESTDRLKGMALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAE 284

  Fly    75 -----HGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGATQ----- 129
                 ..:|..||||..|....|..:.||:||...|.:.:.:||.:.|..  |.:.|.|.     
Human   285 RGKAKDADLRPGDIIVAINGESAEGMLHAEAQSKIRQSPSPLRLQLDRSQ--ATSPGQTNGDSSL 347

  Fly   130 ---------------EAGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTV 179
                           |:....||:.:.|   ..|.|..| |||.|.||    :..|..:......
Human   348 EVLATRFQGSVRTYTESQSSLRSSYSSP---TSLSPRAG-SPFSPPPS----SSSLTGEAAISRS 404

  Fly   180 FPQLNSSGGYEVPSTV-FSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYL 243
            |..|..|.|......: :|.:|        ...||.: .:...:..||||               
Human   405 FQSLACSPGLPAADRLSYSGRP--------GSRQAGL-GRAGDSAVLVLP--------------- 445

  Fly   244 RHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIEDTIR 308
               |:|..                                                        |
Human   446 ---PSPGP--------------------------------------------------------R 451

  Fly   309 STVPFATSESNRL---KDSPLHRPLPTKLNGYKKTVQYDPRNSETYRAIQ------EEGGYSNYG 364
            |:.|...||...|   :||.:.:.|.....|     :..||.|.::|.:|      |.||     
Human   452 SSRPSMDSEGGSLLLDEDSEVFKMLQENREG-----RAAPRQSSSFRLLQEALEAEERGG----- 506

  Fly   365 QSSPQEVTIPVQTKVYQPNRLVP-GKKPVSAPVSRPP 400
                        |..:.|:.|.| ...|.|..::.||
Human   507 ------------TPAFLPSSLSPQSSLPASRALATPP 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 18/74 (24%)
DUF4749 285..359 CDD:292558 16/82 (20%)
PDLIM2NP_067643.3 PDZ_signaling 259..330 CDD:238492 16/70 (23%)
DUF4749 <462..505 CDD:292558 11/47 (23%)
LIM_Mystique 536..588 CDD:188833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5310
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.