DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and mxtx2

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001073284.1 Gene:mxtx2 / 58078 ZFINID:ZDB-GENE-000710-6 Length:296 Species:Danio rerio


Alignment Length:166 Identity:44/166 - (26%)
Similarity:61/166 - (36%) Gaps:50/166 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SGLKKRVHFADEQNVGVQVGSPAHGELLRGDIISKIGEYDARDLSHADAQQLFRGAG-NEIRLVV 115
            :|.:||..|..|           |.|||:  :...:..|....:    .:.|.:..| .|.|:.|
Zfish    21 AGRRKRTSFTKE-----------HLELLK--MAFNVDPYPGISV----RESLSQATGLPESRIQV 68

  Fly   116 HRDNKIAYT-QGATQEAGPGSRSNSTLPPVTPDLMPHRGPSPFLP------GPSHFERALQ-LPV 172
            ...||.|.| :....::.|...:.|.|            ||||||      |.|..:|.:| .|.
Zfish    69 WFQNKRARTLKNRAIQSSPQLDNKSPL------------PSPFLPPHMASVGVSAQQRGIQESPF 121

  Fly   173 D-----TLPQ-TVFPQLNSSGGYEVPSTVFSPKPTR 202
            :     |.|| ..||    ...|..|  |..|:.||
Zfish   122 NIQMSQTSPQHFTFP----PSDYSTP--VVKPRQTR 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 9/47 (19%)
DUF4749 285..359 CDD:292558
mxtx2NP_001073284.1 HOX 22..76 CDD:197696 17/70 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.