DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and GOPC

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_065132.1 Gene:GOPC / 57120 HGNCID:17643 Length:462 Species:Homo sapiens


Alignment Length:218 Identity:35/218 - (16%)
Similarity:74/218 - (33%) Gaps:71/218 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 DYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVPFATSESNRLK 322
            :.||.:::.......||...|..||:|.:..|        .|..::|:..|.   ...::..::|
Human   118 EVHDQLLQLHSIQLQLHAKTGQSADSGTIKAK--------LSGPSVEELERE---LEANKKEKMK 171

  Fly   323 DSPLHRP-----------------LPTKLNGYKKTVQY-DPRNSETYRAIQEEGGYSNYGQSSPQ 369
            ::.|...                 |..::.|.:...:| |...:...:.||..|          :
Human   172 EAQLEAEVKLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLG----------R 226

  Fly   370 EVTIPVQTKVYQP-------------NRLVPGKKPVSAPVSRPPYNVVNTHD-ENIRQS---GSF 417
            ::..|...|::..             .|...|:..:..|:..||     .|| :::::|   |..
Human   227 DMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDLKRPMQAPP-----GHDQDSLKKSQGVGPI 286

  Fly   418 NRLM----------YSVIGATEY 430
            .:::          .|:.|..|:
Human   287 RKVLLLKEDHEGLGISITGGKEH 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492
DUF4749 285..359 CDD:292558 12/91 (13%)
GOPCNP_065132.1 bZIP_2 <166..199 CDD:285017 3/32 (9%)
PDZ_signaling 286..368 CDD:238492 3/24 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 426..449
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.