DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and pdlim4

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001036161.1 Gene:pdlim4 / 569404 ZFINID:ZDB-GENE-070308-5 Length:349 Species:Danio rerio


Alignment Length:344 Identity:65/344 - (18%)
Similarity:109/344 - (31%) Gaps:133/344 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 AHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGATQEAGPGSRSN 138
            |...|..||.|..|.......::|.:||...:...:::.|.:.|..| |:               
Zfish    39 AQSNLSPGDTILAINGESTESMTHMEAQNRIKACTDQLVLAICRSGK-AW--------------- 87

  Fly   139 STLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFSPKPTRD 203
                  :|..|.....|||.|              ||              |..|..|.|     
Zfish    88 ------SPTGMEELKTSPFSP--------------TL--------------ESDSQTFRP----- 113

  Fly   204 HQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRHYPNPAVRAHPGHDYHDSIMKQRV 268
                        ::..|..||        |..:|         .:|...|.|   |::.      
Zfish   114 ------------ISSGYSPTP--------KSPSP---------KSPITGAVP---YNNG------ 140

  Fly   269 ADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTV-------PFATSESNRLKDSPL 326
                     ||        ...:|:|.||||:||....:...:       |.:.|....:..|..
Zfish   141 ---------GS--------RPVYNNPAGLYSHNNGNGALPKQMSGLSLGSPHSFSPEPPVNSSGN 188

  Fly   327 HRPLPTKLNGYKKTVQYD-----PRNSETYRAIQ-----EEGGYSNYGQSSPQEVTIPVQTKVYQ 381
            .....|:.:.|:..:.|:     |:.|.:::.:|     |:||.|...:|..:.:..||::.|.:
Zfish   189 RNGFDTQSDVYRMLLDYEEPVSAPKQSGSFKYLQGILEAEDGGVSPVDRSGVRGLRSPVKSPVPK 253

  Fly   382 PNRLVPGKKPVSAPVSRPP 400
            ..      .|::||::..|
Zfish   254 LG------SPITAPLAPIP 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 10/40 (25%)
DUF4749 285..359 CDD:292558 18/90 (20%)
pdlim4NP_001036161.1 PDZ_signaling 3..78 CDD:238492 9/38 (24%)
DUF4749 146..233 CDD:292558 20/86 (23%)
LIM_RIL 274..326 CDD:188835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5287
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.