DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and grip2a

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_017212845.1 Gene:grip2a / 568084 ZFINID:ZDB-GENE-081104-132 Length:1100 Species:Danio rerio


Alignment Length:387 Identity:80/387 - (20%)
Similarity:127/387 - (32%) Gaps:145/387 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VPLPSPCRRRSSSGLKKRVHFADEQNVG-------VQVGSPAH--GELLRGDIISKIGEYDARDL 95
            |.||   :||   |::..:..:..:..|       :|.||.||  |.|..||.:..|......:.
Zfish   600 VKLP---KRR---GVELGITISASKKAGKPLIISEIQKGSIAHRIGTLEPGDRLLAIDNVRLDNC 658

  Fly    96 SHADAQQLFRGAGNEIRLVVHRD----------NKIAYTQGATQEAGP-GSRSNSTLPPVTPDL- 148
            ...:|..:.:.|...::|.:.:|          ..:.:|....:..|| |...:.|..|..|.| 
Zfish   659 GMEEAMMVLQQAEGMVKLRIQKDEDNLDELESSGSVIFTVELKRHGGPLGITISGTEEPFNPILI 723

  Fly   149 -------MPHRGPSPFLPGPSHF-ERALQLP---------------VDTLPQTVF--------PQ 182
                   :.||      .|..|. :|.|.:.               :.|...||.        |.
Zfish   724 SSLTRNGLAHR------TGALHIGDRVLAINNMSLKGKPLSEAIHLLQTAGDTVTLKIKKRSDPL 782

  Fly   183 LNSSGGYEVPSTVFSPKPTRDHQQDVDEEQA-AIVNQPY-----RTTPLVLPGAKVKKDAPTTES 241
            |:|..|        ||..|.....|:::::: :.....|     :|||            |:.:|
Zfish   783 LDSERG--------SPSRTASCVSDMEDDRSDSFRRGKYSDLLRQTTP------------PSLDS 827

  Fly   242 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIEDT 306
            .:..:.:.|:.|..|   ...:...|.:|..||     .:|..:..|:   ||:           
Zfish   828 AMDSWDSSALDAGYG---SQGVYIHRPSDFTLH-----PSDWRQTNHR---SPL----------- 870

  Fly   307 IRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTVQYDPRNSETYRAIQEEGGYSNYGQSSP 368
                          :...|.|||          || ||.|.||      |:..||  |..||
Zfish   871 --------------MSRRPAHRP----------TV-YDGRLSE------EDWTYS--GSVSP 899

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 13/48 (27%)
DUF4749 285..359 CDD:292558 15/73 (21%)
grip2aXP_017212845.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.