DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and pdzd3b

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001124259.1 Gene:pdzd3b / 566852 ZFINID:ZDB-GENE-081022-151 Length:524 Species:Danio rerio


Alignment Length:305 Identity:70/305 - (22%)
Similarity:102/305 - (33%) Gaps:93/305 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YRPQPTPKPPLVPLPSP---CRRRSSSGLKKRVHFADEQNVGVQVGSPAH-GELLRGDIISKIGE 89
            ||||   :..||..|..   ..|:...|..:.||...|    |..||||. |.:..|:::.::..
Zfish   254 YRPQ---RLHLVMGPDGYGFLLRQEKGGAGRTVHMVRE----VDKGSPAELGGVKEGEMLLEVNG 311

  Fly    90 YDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGATQEAGPGSRSNSTLPPVTPDLMPHRGP 154
            .....|||.|.....|.:|.::.|                         :|:.|...|.....|.
Zfish   312 ESTDPLSHKDVVSNIRQSGQQVTL-------------------------TTMTPQGYDFYTKLGL 351

  Fly   155 SPFL---PGPSHF-ERALQLPVDTLPQT--VFP----QLN----------SSGGY--------EV 191
            ||.|   ..||.. |...::||...|..  |.|    |:|          ||.|:        :.
Zfish   352 SPLLFCVDVPSALPEVKKEIPVTPKPAVPPVEPQEEVQINPNVRRCILERSSAGFGFHLGCVQQK 416

  Fly   192 PSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRHYPNPA------ 250
            |.|..|........|.....|..:|        :.:.|..|:|:  :.|..:.|.....      
Zfish   417 PGTFISQVAAGSPGQSSGLFQGDVV--------VEVNGQNVEKE--SLEDVIMHVKRGGETLSLL 471

  Fly   251 VRAHPGHDYHDSIMKQRVADTMLHKV---------VGSEADTGRV 286
            |....|:|:    :||......|:|:         |.|.|:|.||
Zfish   472 VVDQKGYDW----LKQNGKPVTLNKLETISEVEESVSSSAETARV 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 14/47 (30%)
DUF4749 285..359 CDD:292558 2/2 (100%)
pdzd3bNP_001124259.1 PDZ_signaling 44..118 CDD:238492
PDZ 148..227 CDD:214570
PDZ_signaling 264..336 CDD:238492 20/100 (20%)
PDZ 393..473 CDD:214570 14/89 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.