DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and ush1c

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_009296312.1 Gene:ush1c / 564412 ZFINID:ZDB-GENE-060312-41 Length:586 Species:Danio rerio


Alignment Length:255 Identity:47/255 - (18%)
Similarity:84/255 - (32%) Gaps:86/255 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ELPTSYRPQPTPKPP----LVPLPSPCRRRSSSGLKKRVHFADEQNVGVQVGSPAHGELLRGDII 84
            |...|..|..:|.||    |.|.|.|....:.|       :.:|...|.|               
Zfish   385 EKKKSVSPAASPSPPPPTRLAPSPKPKTSTADS-------YEEETGEGFQ--------------- 427

  Fly    85 SKIGEYDARDLSHADAQQLFRGAGNEIRLV-VHRDNKI-------------------AYTQGATQ 129
            ..:.::|..  |...|:|:   ||.::||: :.::.|:                   .|..||..
Zfish   428 KYVDDFDPH--SMFTAEQI---AGRDVRLLRIKKEGKLDLAIEGGIDSPLGKIVVSSIYEGGAAD 487

  Fly   130 EAG---PGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEV 191
            :.|   .|....:....:..|:....|                       ||...|..:|||..:
Zfish   488 KHGGVVSGDEIMAVNGKILTDVTLAEG-----------------------QTSMAQAWNSGGDWI 529

  Fly   192 PSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTT------PLVLPGAKVKKDAPTTESYLRH 245
             ..|.:..|.::::.:|  .:||.|....:.|      |:...|..::...|.:.:::.|
Zfish   530 -DLVIAVSPPKEYEDEV--PKAASVRPTAKKTVFQGSAPVYRQGYVLQMKTPPSPNFISH 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 9/47 (19%)
DUF4749 285..359 CDD:292558
ush1cXP_009296312.1 harmonin_N 2..80 CDD:259819
PDZ_signaling 85..165 CDD:238492
PDZ_signaling 212..292 CDD:238492
RILP-like 317..>379 CDD:304877
PDZ_signaling 447..534 CDD:238492 17/110 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.