DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Pdlim5

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_006501801.1 Gene:Pdlim5 / 56376 MGIID:1927489 Length:734 Species:Mus musculus


Alignment Length:399 Identity:76/399 - (19%)
Similarity:130/399 - (32%) Gaps:108/399 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SPAHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGATQEAGPGSR 136
            |.||..:  ||::..|....|:.::|.:||...:.....:.:.:.|.:..|.::..:.:.|....
Mouse    40 SQAHVRI--GDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVSVQKGEPKE 102

  Fly   137 SNSTLPPVTP---------DLMPHRGPSPF--LPGPSHFERALQLPVDTLPQTVFPQLNSSGGYE 190
            ....:|..:|         ::..::.|.||  :..|.         |.::|.             
Mouse   103 VVKPVPITSPAVSKVTSTTNMAYNKAPRPFGSVSSPK---------VTSIPS------------- 145

  Fly   191 VPSTVFSP--KPTRDHQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRHYPN---PA 250
             ||:.|:|  ..|..|........|         |||.|..:.:...|..:.......||   ||
Mouse   146 -PSSAFTPAHAATSSHASPTPVAAA---------TPLHLSASGLHVSANLSADQCSSPPNTGKPA 200

  Fly   251 VRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVPFAT 315
            |.. |......|:..:...:....:..||:.|.     ||.|...|         |::       
Mouse   201 VNV-PRQPTVTSVCSESAQELAEGQRRGSQGDI-----KQQNGNPG---------TVK------- 243

  Fly   316 SESNRLKDSPLHRP--------------LPTKLNGYKK-----TVQYDPR----NSETYRAIQEE 357
                    .|..||              :||..:..||     |..:.||    .|.::|.:.:.
Mouse   244 --------IPPKRPPRKHIVERNTEFYHIPTHSDASKKRLIEDTEDWRPRTGTTQSRSFRILAQI 300

  Fly   358 GGYSNYGQSSPQEVTIPVQTKVYQ--PNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSGSFNRL 420
            .|..:..:|......   :.|.|.  .:.|..|..|.:||.....::.|....:......|.:|.
Mouse   301 TGTEHLTESENDNTK---KAKFYSSLEDPLKNGPHPPAAPQLLKVHSQVAIVSKEAATYSSVSRS 362

  Fly   421 MYSVIGATE 429
            ..:|.||.|
Mouse   363 TRTVEGALE 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 10/42 (24%)
DUF4749 285..359 CDD:292558 17/96 (18%)
Pdlim5XP_006501801.1 PDZ_signaling 10..82 CDD:238492 10/43 (23%)
PHA03307 150..>540 CDD:223039 53/264 (20%)
DUF4749 214..315 CDD:374237 22/129 (17%)
LIM1_ENH 558..609 CDD:188837
LIM2_ENH 617..668 CDD:188841
LIM3_ENH 676..730 CDD:188843
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5305
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.180

Return to query results.
Submit another query.