DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and pdlim3b

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_005157291.1 Gene:pdlim3b / 561865 ZFINID:ZDB-GENE-060130-104 Length:332 Species:Danio rerio


Alignment Length:398 Identity:76/398 - (19%)
Similarity:127/398 - (31%) Gaps:176/398 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VQVGSPA-HGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHR-DNKIAYTQGATQE 130
            |..||.| ...|..||||..|.......::||:||...:.:.|::.|.:.| :.||         
Zfish    32 VTPGSKASRVNLCPGDIILSIQGVSTDGMTHAEAQNNIKDSTNQLFLKIERPETKI--------- 87

  Fly   131 AGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTV 195
                         .:|.::.....:||                        ::|...        
Zfish    88 -------------WSPQVIEEGKVNPF------------------------KINLEA-------- 107

  Fly   196 FSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRH----YPNPAVRAHPG 256
                    .:||:|                                |..|    .|.|...|...
Zfish   108 --------EKQDID--------------------------------YFEHKFNVRPKPFTSASQR 132

  Fly   257 HDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIEDTIR----STVPFATSE 317
            .|.....:...||     ::.|:.:....|   |:|||:.|||.:|:.:|::    |||....|.
Zfish   133 SDSTSQTLMGNVA-----QMAGTPSTAHSV---QYNSPVALYSADNVSNTLQQAQMSTVVRQASP 189

  Fly   318 SNR----LKDSPLHRPLPTKLNGYKKTVQYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTK 378
            |::    ::||.::|.|..     .....::||.|.:::|:|:      |.:|   :.|.|:.| 
Zfish   190 SSKPLTSIEDSHVYRMLQD-----ANEQPHEPRQSGSFKALQD------YVES---DGTRPMVT- 239

  Fly   379 VYQPNRLVPGKKPVSAPVSRPPY--------------------NVVNTHDE-------------- 409
                       :.|.|||::|..                    .||...|:              
Zfish   240 -----------RSVKAPVTKPQAATSSLQKLPLCDKCGTGIVGTVVKARDKYRHPACFVCSDCGM 293

  Fly   410 NIRQSGSF 417
            |::|.|.|
Zfish   294 NLKQKGYF 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 16/47 (34%)
DUF4749 285..359 CDD:292558 24/81 (30%)
pdlim3bXP_005157291.1 PDZ_signaling 2..81 CDD:238492 16/48 (33%)
DUF4749 156..232 CDD:292558 26/92 (28%)
LIM_ALP 262..314 CDD:188834 7/40 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5287
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.180

Return to query results.
Submit another query.