DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and lnx1

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_005160562.1 Gene:lnx1 / 561226 ZFINID:ZDB-GENE-030131-9439 Length:769 Species:Danio rerio


Alignment Length:315 Identity:62/315 - (19%)
Similarity:108/315 - (34%) Gaps:115/315 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LKKRVHFADEQNVGVQ-VGSP-AHG----ELLRGDIISKIGE------------YDARDLSHADA 100
            |.||   |.::.:|:: |..| .||    .||.|.:.::.|.            :|.|..:...|
Zfish   415 LVKR---APDEQLGIKLVRRPDEHGVFIFHLLEGGLAARDGRLRVDDRVLAINGHDLRYGAPEHA 476

  Fly   101 QQLFRGAGNEIRLVVHRDNKIAYTQGATQEAGPGSRSNSTLPPVTPDLMPH-----RGPSPFLP- 159
            ..|.:.:.:.:..:|.|...|.                      .||::..     .||.|:.| 
Zfish   477 ALLIQASEDRVHFIVSRQTHIP----------------------APDILQEAPWNMEGPPPYSPV 519

  Fly   160 -----------GPSHFERALQL---PVDTLPQTVFPQLNSSGGYEVPSTVFSPKPTRDHQQD--- 207
                       .|:.:|:.:.|   |.|:|..||...: ||.|:::|..|.:..|.....|:   
Zfish   520 DIEHTLLDSCQKPACYEKTVTLLKEPHDSLGMTVAGGM-SSRGWDLPVYVTNVDPNGVVGQEGSI 583

  Fly   208 -----------VD----EEQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYL-----RHYPNPAVR 252
                       ||    ....|:.|....::|:||   :|.:..|..||.|     .|.|.....
Zfish   584 RKGDILLNVNGVDLTGVTRSEAVANLKNTSSPVVL---QVLEMRPPNESSLDCMPPLHSPCALSP 645

  Fly   253 AHPG--------HDY-----------------HDSIMKQRVADTMLHKVVGSEAD 282
            :.||        .||                 .|.::::..:.::...:||.:.:
Zfish   646 SSPGDVKLPPPNDDYAPLWVSWLQLPRHLYCCKDIVLRRSTSGSLGFSIVGGQEE 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 12/64 (19%)
DUF4749 285..359 CDD:292558
lnx1XP_005160562.1 RING 57..93 CDD:214546
PDZ_signaling 297..381 CDD:238492
PDZ_signaling 411..491 CDD:238492 17/78 (22%)
PDZ_signaling 536..621 CDD:238492 21/88 (24%)
DegQ <548..621 CDD:223343 17/76 (22%)
PDZ_signaling 678..762 CDD:238492 3/23 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.