DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and grid2ipb

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_009304908.1 Gene:grid2ipb / 559717 ZFINID:ZDB-GENE-040724-161 Length:1383 Species:Danio rerio


Alignment Length:383 Identity:75/383 - (19%)
Similarity:107/383 - (27%) Gaps:148/383 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PGYELPTSYRPQPTP------------KPPLVPLPS------PCRRR------------------ 49
            ||.:..|..:...:|            .||..||||      |.||:                  
Zfish   669 PGPQFETYQQTVASPDSVDSNPYVSLDSPPASPLPSDELSPLPQRRKLFTFSRPPRSRDTDKFLD 733

  Fly    50 -SSSGLKKRVHFADEQNVGVQVGSPAHGELLRGDIISKIGEYDARDLSHADAQQL------FRGA 107
             .|..|..||:..|:                     .|.||.|..::|..|.|::      ...|
Zfish   734 ALSEQLGHRVNIVDD---------------------FKGGENDYEEMSFQDEQEVNMLPHELSSA 777

  Fly   108 GNEIRLVVHRDNKIAYTQGATQEAGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPV 172
            .:|..........::|:.|:.....|    ..:.||..|.|.....|||....|.|         
Zfish   778 SSEDHSSSDDSTSVSYSSGSDHIPPP----PQSPPPPPPPLQFTDSPSPLPITPEH--------- 829

  Fly   173 DTLPQTVFPQLNSSGGYEVPSTVFS--------PKPTRDHQQD---------VDEEQAAIVNQPY 220
              |||              |...|.        |.|.|....:         ..||..|..:.|.
Zfish   830 --LPQ--------------PPPAFQHHPIIAPPPPPPRPFLANRPSLHKVLPTREELRAQHSHPR 878

  Fly   221 RTTPLVLPGAKVKKDAPTTESYLR-HYP--------NPAVRAHPGHDYHDSIMKQRVADTMLHKV 276
            |::|           .|:::..|: |.|        :|.....|.|........|..:.::....
Zfish   879 RSSP-----------QPSSQPILQLHQPKAHPILQSSPHTSPQPPHTSAQHTRLQHPSQSIYQSQ 932

  Fly   277 VGSEADTGRVFHKQ---FNSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLP 331
            ..:...|.....||   .:.|    |..:.|.|:.|.||           .|...|||
Zfish   933 QTTVPRTSPSLTKQKSLHSQP----SQQSFEGTLSSKVP-----------PPPPPPLP 975

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 9/52 (17%)
DUF4749 285..359 CDD:292558 13/50 (26%)
grid2ipbXP_009304908.1 PDZ_signaling 9..69 CDD:238492
PDZ_signaling 80..156 CDD:238492
HN_L-delphilin-R1_like 183..262 CDD:259820
PDZ_signaling 335..410 CDD:238492
HN_L-delphilin-R2_like 451..530 CDD:259821
FH2 995..1360 CDD:280362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.