Sequence 1: | NP_729395.2 | Gene: | Zasp66 / 38988 | FlyBaseID: | FBgn0035917 | Length: | 430 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001035013.1 | Gene: | tamalin / 558950 | ZFINID: | ZDB-GENE-060312-30 | Length: | 382 | Species: | Danio rerio |
Alignment Length: | 286 | Identity: | 60/286 - (20%) |
---|---|---|---|
Similarity: | 93/286 - (32%) | Gaps: | 98/286 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 WKVPGYELPTSYRPQPTPKPPLVPLPSPCRRRSSSGLKKR---VHFADEQNV-------GVQVGS 72
Fly 73 PAHGELLR----GDIISKIGEYDARDLSHADAQQLFRGAGNEIRL-VVHRDN--------KIAYT 124
Fly 125 QGATQEAGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGY 189
Fly 190 EVPSTVFSPKPTR--------------DHQQDVDEE-----QAAIVN---------QPYRTTP-L 225
Fly 226 VLPGAKVKKDAPT-------TESYLR 244 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zasp66 | NP_729395.2 | PDZ_signaling | <68..115 | CDD:238492 | 17/51 (33%) |
DUF4749 | 285..359 | CDD:292558 | |||
tamalin | NP_001035013.1 | PDZ_signaling | 90..175 | CDD:238492 | 22/91 (24%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |