DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and lnx2a

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001106696.2 Gene:lnx2a / 553331 ZFINID:ZDB-GENE-060228-2 Length:737 Species:Danio rerio


Alignment Length:225 Identity:53/225 - (23%)
Similarity:82/225 - (36%) Gaps:61/225 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SYRPQPTPKPPLVPLPSPC-------RRRSSSGLK-KRVHFADEQNVGV----QVGSPA-HGELL 79
            |.||   |.....|..||.       :|.||..|. |.|...||..|.:    :.|..| .|.|.
Zfish   358 SARP---PAATASPKGSPASIRITLHKRESSEQLGIKLVRRTDEAGVFILDLLEGGLAAKDGRLC 419

  Fly    80 RGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNK--IAYTQGATQEAGPGSRSNSTLP 142
            ..|.:..:.|:|.|..:...|.|:.:.:|..:.|::.|.:|  :|...|:|              
Zfish   420 SNDRVLAVNEHDLRHGTPELAAQIIQASGERVNLLISRSSKQTMAVHTGST-------------- 470

  Fly   143 PVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFSPKPT-RDHQQ 206
             :|.|:..|          .|        :..||.|..|.       .|||...:...| ||..|
Zfish   471 -LTRDIWSH----------DH--------IPPLPSTATPS-------PVPSLHLARSSTQRDLSQ 509

  Fly   207 DVD--EEQAAIVNQPYRTTPLVLPGAKVKK 234
            .|:  |:...:..:|:.:..:.:.|.:..|
Zfish   510 CVNCKEKHITVKKEPHESLGMTVAGGRGSK 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 12/51 (24%)
DUF4749 285..359 CDD:292558
lnx2aNP_001106696.2 zf-RING_2 49..87 CDD:290367
PDZ 267..353 CDD:214570
PDZ_signaling 375..455 CDD:238492 21/79 (27%)
PDZ_signaling 515..600 CDD:238492 4/25 (16%)
PDZ_signaling 646..730 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.